Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1452568..1453484 | Replicon | chromosome |
Accession | NZ_CP123994 | ||
Organism | Bacillus inaquosorum strain M3 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | QHF92_RS07150 | Protein ID | WP_060398450.1 |
Coordinates | 1452738..1453484 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4NV07 |
Locus tag | QHF92_RS07145 | Protein ID | WP_003239095.1 |
Coordinates | 1452568..1452738 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QHF92_RS07105 (QHF92_07105) | 1447648..1449417 | + | 1770 | WP_248596976.1 | terminase | - |
QHF92_RS07110 (QHF92_07110) | 1449429..1449758 | + | 330 | WP_060398446.1 | XkdW family protein | - |
QHF92_RS07115 (QHF92_07115) | 1449755..1449919 | + | 165 | WP_019258164.1 | XkdX family protein | - |
QHF92_RS07120 (QHF92_07120) | 1449966..1450805 | + | 840 | WP_060398447.1 | hypothetical protein | - |
QHF92_RS07125 (QHF92_07125) | 1450858..1451127 | + | 270 | WP_060398448.1 | hemolysin XhlA family protein | - |
QHF92_RS07130 (QHF92_07130) | 1451140..1451403 | + | 264 | WP_003239099.1 | phage holin | - |
QHF92_RS07135 (QHF92_07135) | 1451416..1452309 | + | 894 | WP_060398449.1 | N-acetylmuramoyl-L-alanine amidase | - |
QHF92_RS07140 (QHF92_07140) | 1452346..1452483 | - | 138 | WP_119913750.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
QHF92_RS07145 (QHF92_07145) | 1452568..1452738 | - | 171 | WP_003239095.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
QHF92_RS07150 (QHF92_07150) | 1452738..1453484 | - | 747 | WP_060398450.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
QHF92_RS07155 (QHF92_07155) | 1453594..1454595 | - | 1002 | WP_003239093.1 | inorganic phosphate transporter | - |
QHF92_RS07160 (QHF92_07160) | 1454608..1455225 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
QHF92_RS07165 (QHF92_07165) | 1455501..1456817 | - | 1317 | WP_060398451.1 | serine/threonine exchanger | - |
QHF92_RS07170 (QHF92_07170) | 1457203..1458153 | + | 951 | WP_060398452.1 | ring-cleaving dioxygenase | - |
QHF92_RS07175 (QHF92_07175) | 1458254..1458399 | + | 146 | Protein_1353 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29097.57 Da Isoelectric Point: 4.6191
>T279314 WP_060398450.1 NZ_CP123994:c1453484-1452738 [Bacillus inaquosorum]
MLLFFQIMVWCVMAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPSSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQNRLDRKDVYYDQYGKMVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCVMAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPSSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQNRLDRKDVYYDQYGKMVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|