Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3089976..3090654 | Replicon | chromosome |
Accession | NZ_CP123993 | ||
Organism | Acinetobacter baumannii strain Ab4294 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | QE150_RS15410 | Protein ID | WP_000009390.1 |
Coordinates | 3089976..3090155 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QE150_RS15415 | Protein ID | WP_005112025.1 |
Coordinates | 3090241..3090654 (+) | Length | 138 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE150_RS15390 (QE150_15395) | 3085791..3086642 | - | 852 | WP_005112021.1 | GPO family capsid scaffolding protein | - |
QE150_RS15395 (QE150_15400) | 3086821..3088599 | + | 1779 | WP_005112022.1 | terminase family protein | - |
QE150_RS15400 (QE150_15405) | 3088596..3089642 | + | 1047 | WP_194299481.1 | phage portal protein | - |
QE150_RS15405 (QE150_15410) | 3089653..3089868 | + | 216 | WP_227552920.1 | hypothetical protein | - |
QE150_RS15410 (QE150_15415) | 3089976..3090155 | + | 180 | WP_000009390.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QE150_RS15415 (QE150_15420) | 3090241..3090654 | + | 414 | WP_005112025.1 | hypothetical protein | Antitoxin |
QE150_RS15420 (QE150_15425) | 3090911..3091429 | - | 519 | WP_031945607.1 | hypothetical protein | - |
QE150_RS15445 (QE150_15450) | 3092622..3093686 | - | 1065 | WP_001278264.1 | quinolinate synthase NadA | - |
QE150_RS15450 (QE150_15455) | 3093833..3095053 | - | 1221 | WP_270901294.1 | bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3047961..3090654 | 42693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6799.11 Da Isoelectric Point: 11.1422
>T279312 WP_000009390.1 NZ_CP123993:3089976-3090155 [Acinetobacter baumannii]
MSFNEFKRWLIAQGVIFVRKGKGSHMIIEFNGKKTVFPNHGKKEIPEGTRLKIKKDLGL
MSFNEFKRWLIAQGVIFVRKGKGSHMIIEFNGKKTVFPNHGKKEIPEGTRLKIKKDLGL
Download Length: 180 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15362.75 Da Isoelectric Point: 6.2451
>AT279312 WP_005112025.1 NZ_CP123993:3090241-3090654 [Acinetobacter baumannii]
MKCYVSIHREGEAFIVSSSELPELNSVGYTLEEALSEALDGIETVFEIYMDERKAIPLPSKGKKGEYVVHLPVRVAAKVR
LYNEMISQNVTKAELARRLGWLQKQADRLLSLKHSTKLESIESAFQALGKDLDIVIA
MKCYVSIHREGEAFIVSSSELPELNSVGYTLEEALSEALDGIETVFEIYMDERKAIPLPSKGKKGEYVVHLPVRVAAKVR
LYNEMISQNVTKAELARRLGWLQKQADRLLSLKHSTKLESIESAFQALGKDLDIVIA
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|