Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 450374..451027 | Replicon | chromosome |
Accession | NZ_CP123993 | ||
Organism | Acinetobacter baumannii strain Ab4294 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | QE150_RS03015 | Protein ID | WP_270901074.1 |
Coordinates | 450638..451027 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | QE150_RS03010 | Protein ID | WP_001288210.1 |
Coordinates | 450374..450631 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE150_RS02990 (QE150_02990) | 445890..446897 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
QE150_RS02995 (QE150_02995) | 446916..447293 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
QE150_RS03000 (QE150_03000) | 447475..448965 | + | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
QE150_RS03005 (QE150_03005) | 449014..450186 | - | 1173 | WP_001190555.1 | acyl-CoA dehydrogenase family protein | - |
QE150_RS03010 (QE150_03010) | 450374..450631 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
QE150_RS03015 (QE150_03015) | 450638..451027 | + | 390 | WP_270901074.1 | hypothetical protein | Toxin |
QE150_RS03020 (QE150_03020) | 451797..452882 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
QE150_RS03025 (QE150_03025) | 452960..453526 | + | 567 | WP_000651536.1 | rhombosortase | - |
QE150_RS03030 (QE150_03030) | 453714..455909 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15572.94 Da Isoelectric Point: 10.3607
>T279311 WP_270901074.1 NZ_CP123993:450638-451027 [Acinetobacter baumannii]
MINHLNFKLKYSLFSIIFQLFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSLFSIIFQLFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|