Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumAB/upstrm_HI1419-dnstrm_HI1420
Location 11948..12532 Replicon plasmid pAb4294
Accession NZ_CP123992
Organism Acinetobacter baumannii strain Ab4294

Toxin (Protein)


Gene name PumA Uniprot ID N9JY46
Locus tag QE150_RS00055 Protein ID WP_000286963.1
Coordinates 11948..12250 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID -
Locus tag QE150_RS00060 Protein ID WP_000985610.1
Coordinates 12251..12532 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE150_RS00030 (QE150_00030) 7173..8776 - 1604 Protein_5 IS66 family transposase -
QE150_RS00035 (QE150_00035) 8846..9181 - 336 WP_004691519.1 IS66 family insertion sequence element accessory protein TnpB -
QE150_RS00040 (QE150_00040) 9178..9561 - 384 WP_004762545.1 transposase -
QE150_RS00045 (QE150_00045) 10297..11079 - 783 WP_006582115.1 hypothetical protein -
QE150_RS00050 (QE150_00050) 11365..11748 - 384 WP_281309336.1 hypothetical protein -
QE150_RS00055 (QE150_00055) 11948..12250 + 303 WP_000286963.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QE150_RS00060 (QE150_00060) 12251..12532 + 282 WP_000985610.1 putative addiction module antidote protein Antitoxin
QE150_RS00065 (QE150_00065) 12760..13693 + 934 Protein_12 IS5-like element ISAba13 family transposase -
QE150_RS00070 (QE150_00070) 13757..14128 - 372 WP_009501156.1 RcnB family protein -
QE150_RS00075 (QE150_00075) 14465..14695 + 231 WP_009501150.1 hypothetical protein -
QE150_RS00080 (QE150_00080) 14865..15401 - 537 WP_009501148.1 porin family protein -
QE150_RS00085 (QE150_00085) 16109..16465 + 357 WP_000269903.1 type II toxin-antitoxin system RelE/ParE family toxin -
QE150_RS00090 (QE150_00090) 16458..16760 + 303 WP_001140619.1 XRE family transcriptional regulator -
QE150_RS00095 (QE150_00095) 16753..16962 + 210 WP_000069471.1 hypothetical protein -
QE150_RS00100 (QE150_00100) 17087..17299 - 213 WP_016653394.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..154924 154924
- inside IScluster/Tn - - 5266..20830 15564


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11545.02 Da        Isoelectric Point: 4.6838

>T279309 WP_000286963.1 NZ_CP123992:11948-12250 [Acinetobacter baumannii]
MYSIYTTEAFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL

Download         Length: 303 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10109.67 Da        Isoelectric Point: 8.0018

>AT279309 WP_000985610.1 NZ_CP123992:12251-12532 [Acinetobacter baumannii]
MAIKLRKWDSAEHLKTEEDMQAYLQACIDESNGDAAFIAKALGNIAKAKGMAQLSRDTGLGRESLYKALSGDVNPSFDTV
IKVVKALNLRLAI

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A836MGN2

Antitoxin

Source ID Structure

References