Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1977212..1977680 Replicon chromosome
Accession NZ_CP123983
Organism Staphylococcus haemolyticus strain SH9361

Toxin (Protein)


Gene name TsaT Uniprot ID Q4L4Q4
Locus tag QHG39_RS09710 Protein ID WP_011276326.1
Coordinates 1977492..1977680 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID A0A318R523
Locus tag QHG39_RS09705 Protein ID WP_016931010.1
Coordinates 1977212..1977469 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QHG39_RS09670 (QHG39_09670) 1972375..1973100 - 726 WP_016931016.1 type I 3-dehydroquinate dehydratase -
QHG39_RS09675 (QHG39_09675) 1973263..1973685 + 423 WP_016931015.1 organic hydroperoxide resistance protein -
QHG39_RS09680 (QHG39_09680) 1973962..1974453 + 492 WP_016931014.1 GNAT family N-acetyltransferase -
QHG39_RS09685 (QHG39_09685) 1974584..1975201 + 618 WP_016931013.1 LysE family transporter -
QHG39_RS09690 (QHG39_09690) 1975389..1975997 - 609 WP_016931012.1 histidine phosphatase family protein -
QHG39_RS09695 (QHG39_09695) 1976224..1976466 + 243 WP_011276324.1 hypothetical protein -
QHG39_RS09700 (QHG39_09700) 1976458..1976661 - 204 WP_016931011.1 sterile alpha motif-like domain-containing protein -
QHG39_RS09705 (QHG39_09705) 1977212..1977469 + 258 WP_016931010.1 hypothetical protein Antitoxin
QHG39_RS09710 (QHG39_09710) 1977492..1977680 + 189 WP_011276326.1 hypothetical protein Toxin
QHG39_RS09715 (QHG39_09715) 1977798..1978379 + 582 WP_016931009.1 lipoprotein N-acylation protein LnsA -
QHG39_RS09720 (QHG39_09720) 1978427..1978585 - 159 WP_256098341.1 hypothetical protein -
QHG39_RS09725 (QHG39_09725) 1978832..1979578 + 747 WP_016931007.1 membrane lipoprotein lipid attachment site-containing protein -
QHG39_RS09730 (QHG39_09730) 1979648..1980256 - 609 WP_016931006.1 N-acetyltransferase -
QHG39_RS09735 (QHG39_09735) 1980393..1981139 + 747 WP_016931005.1 poly-gamma-glutamate hydrolase family protein -
QHG39_RS09740 (QHG39_09740) 1981215..1981502 + 288 WP_016931004.1 hypothetical protein -
QHG39_RS09745 (QHG39_09745) 1981742..1981966 + 225 WP_016931003.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7110.80 Da        Isoelectric Point: 9.6269

>T279305 WP_011276326.1 NZ_CP123983:1977492-1977680 [Staphylococcus haemolyticus]
MSLHLTILLWLGIIFVIAASIILGLLLKSKKEERKESYLGFTVIFYIFGFALLIYVFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9864.88 Da        Isoelectric Point: 4.1050

>AT279305 WP_016931010.1 NZ_CP123983:1977212-1977469 [Staphylococcus haemolyticus]
MNNNKIFWINIFITLLFLGFNIIVTYNAELDDFFWLIPGLTISGITIVLSLSTALICKNLVSEVIFLINIAMLLYYIYPI
VYTFF

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A1KAB5

Antitoxin

Source ID Structure
AlphaFold DB A0A318R523

References