Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1041506..1042277 | Replicon | chromosome |
| Accession | NZ_CP123983 | ||
| Organism | Staphylococcus haemolyticus strain SH9361 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | QHG39_RS05355 | Protein ID | WP_011275410.1 |
| Coordinates | 1042128..1042277 (+) | Length | 50 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | Q4L7F8 |
| Locus tag | QHG39_RS05350 | Protein ID | WP_011275409.1 |
| Coordinates | 1041506..1042105 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QHG39_RS05330 (QHG39_05330) | 1037389..1038843 | + | 1455 | WP_049426528.1 | ABC transporter substrate-binding protein/permease | - |
| QHG39_RS05335 (QHG39_05335) | 1038836..1039558 | + | 723 | WP_016931345.1 | amino acid ABC transporter ATP-binding protein | - |
| QHG39_RS05340 (QHG39_05340) | 1039736..1040863 | + | 1128 | WP_281133008.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| QHG39_RS05345 (QHG39_05345) | 1040864..1041334 | + | 471 | WP_049394705.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| QHG39_RS05350 (QHG39_05350) | 1041506..1042105 | + | 600 | WP_011275409.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| QHG39_RS05355 (QHG39_05355) | 1042128..1042277 | + | 150 | WP_011275410.1 | SAS053 family protein | Toxin |
| QHG39_RS05360 (QHG39_05360) | 1042488..1042883 | + | 396 | WP_011275411.1 | hypothetical protein | - |
| QHG39_RS05365 (QHG39_05365) | 1043090..1044475 | + | 1386 | WP_011275412.1 | class II fumarate hydratase | - |
| QHG39_RS05370 (QHG39_05370) | 1044541..1045365 | - | 825 | WP_011275413.1 | RluA family pseudouridine synthase | - |
| QHG39_RS05375 (QHG39_05375) | 1045553..1046662 | + | 1110 | WP_011275414.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5796.18 Da Isoelectric Point: 3.9484
>T279304 WP_011275410.1 NZ_CP123983:1042128-1042277 [Staphylococcus haemolyticus]
MTKNKDSELNYHEEENAMVQDLDDLKTLGKEMEQISEENDEDKLNQSHE
MTKNKDSELNYHEEENAMVQDLDDLKTLGKEMEQISEENDEDKLNQSHE
Download Length: 150 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22272.12 Da Isoelectric Point: 4.7588
>AT279304 WP_011275409.1 NZ_CP123983:1041506-1042105 [Staphylococcus haemolyticus]
MAMNFKVFNDVEHVAEYTADIIRKQFNNNPTTIAGIHLTKDAAPVLDELKKDVDHNAVDFSQVNILDYDDNRSYYEALGV
PASQIYPINLDDDAESLIDDKIKTKENKGKLILQVTSIDESGSLNVNVRQGLLKAREVVLVVTGANKREVVKKLYEENGK
SSFEPSDLKAHRMVTVVLDRAAAEGLPEDVKEYFTARFA
MAMNFKVFNDVEHVAEYTADIIRKQFNNNPTTIAGIHLTKDAAPVLDELKKDVDHNAVDFSQVNILDYDDNRSYYEALGV
PASQIYPINLDDDAESLIDDKIKTKENKGKLILQVTSIDESGSLNVNVRQGLLKAREVVLVVTGANKREVVKKLYEENGK
SSFEPSDLKAHRMVTVVLDRAAAEGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|