279301

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2040433..2040901 Replicon chromosome
Accession NZ_CP123979
Organism Staphylococcus haemolyticus strain SH1275

Toxin (Protein)


Gene name TsaT Uniprot ID Q4L4Q4
Locus tag QHG38_RS09925 Protein ID WP_011276326.1
Coordinates 2040713..2040901 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID A0A318R523
Locus tag QHG38_RS09920 Protein ID WP_016931010.1
Coordinates 2040433..2040690 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QHG38_RS09885 (QHG38_09885) 2035596..2036321 - 726 WP_016931016.1 type I 3-dehydroquinate dehydratase -
QHG38_RS09890 (QHG38_09890) 2036484..2036906 + 423 WP_016931015.1 organic hydroperoxide resistance protein -
QHG38_RS09895 (QHG38_09895) 2037183..2037674 + 492 WP_016931014.1 GNAT family N-acetyltransferase -
QHG38_RS09900 (QHG38_09900) 2037805..2038422 + 618 WP_016931013.1 LysE family transporter -
QHG38_RS09905 (QHG38_09905) 2038610..2039218 - 609 WP_016931012.1 histidine phosphatase family protein -
QHG38_RS09910 (QHG38_09910) 2039445..2039687 + 243 WP_011276324.1 hypothetical protein -
QHG38_RS09915 (QHG38_09915) 2039679..2039882 - 204 WP_016931011.1 sterile alpha motif-like domain-containing protein -
QHG38_RS09920 (QHG38_09920) 2040433..2040690 + 258 WP_016931010.1 hypothetical protein Antitoxin
QHG38_RS09925 (QHG38_09925) 2040713..2040901 + 189 WP_011276326.1 hypothetical protein Toxin
QHG38_RS09930 (QHG38_09930) 2041019..2041600 + 582 WP_016931009.1 lipoprotein N-acylation protein LnsA -
QHG38_RS09935 (QHG38_09935) 2041648..2041884 - 237 WP_016931008.1 hypothetical protein -
QHG38_RS09940 (QHG38_09940) 2042054..2042800 + 747 WP_016931007.1 membrane lipoprotein lipid attachment site-containing protein -
QHG38_RS09945 (QHG38_09945) 2042870..2043478 - 609 WP_016931006.1 N-acetyltransferase -
QHG38_RS09950 (QHG38_09950) 2043615..2044361 + 747 WP_016931005.1 poly-gamma-glutamate hydrolase family protein -
QHG38_RS09955 (QHG38_09955) 2044437..2044724 + 288 WP_016931004.1 hypothetical protein -
QHG38_RS09960 (QHG38_09960) 2044964..2045188 + 225 WP_016931003.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7110.80 Da        Isoelectric Point: 9.6269

>T279301 WP_011276326.1 NZ_CP123979:2040713-2040901 [Staphylococcus haemolyticus]
MSLHLTILLWLGIIFVIAASIILGLLLKSKKEERKESYLGFTVIFYIFGFALLIYVFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9864.88 Da        Isoelectric Point: 4.1050

>AT279301 WP_016931010.1 NZ_CP123979:2040433-2040690 [Staphylococcus haemolyticus]
MNNNKIFWINIFITLLFLGFNIIVTYNAELDDFFWLIPGLTISGITIVLSLSTALICKNLVSEVIFLINIAMLLYYIYPI
VYTFF

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A1KAB5

Antitoxin

Source ID Structure
AlphaFold DB A0A318R523

References