Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1108495..1109266 | Replicon | chromosome |
| Accession | NZ_CP123979 | ||
| Organism | Staphylococcus haemolyticus strain SH1275 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | QHG38_RS05575 | Protein ID | WP_011275410.1 |
| Coordinates | 1109117..1109266 (+) | Length | 50 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | Q4L7F8 |
| Locus tag | QHG38_RS05570 | Protein ID | WP_011275409.1 |
| Coordinates | 1108495..1109094 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QHG38_RS05550 (QHG38_05550) | 1104378..1105832 | + | 1455 | WP_033079569.1 | ABC transporter substrate-binding protein/permease | - |
| QHG38_RS05555 (QHG38_05555) | 1105825..1106547 | + | 723 | WP_016931345.1 | amino acid ABC transporter ATP-binding protein | - |
| QHG38_RS05560 (QHG38_05560) | 1106725..1107852 | + | 1128 | WP_011275407.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| QHG38_RS05565 (QHG38_05565) | 1107853..1108323 | + | 471 | WP_016931343.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| QHG38_RS05570 (QHG38_05570) | 1108495..1109094 | + | 600 | WP_011275409.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| QHG38_RS05575 (QHG38_05575) | 1109117..1109266 | + | 150 | WP_011275410.1 | SAS053 family protein | Toxin |
| QHG38_RS05580 (QHG38_05580) | 1109477..1109872 | + | 396 | WP_011275411.1 | hypothetical protein | - |
| QHG38_RS05585 (QHG38_05585) | 1110079..1111464 | + | 1386 | WP_037571293.1 | class II fumarate hydratase | - |
| QHG38_RS05590 (QHG38_05590) | 1111530..1112354 | - | 825 | WP_011275413.1 | RluA family pseudouridine synthase | - |
| QHG38_RS05595 (QHG38_05595) | 1112542..1113651 | + | 1110 | WP_011275414.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5796.18 Da Isoelectric Point: 3.9484
>T279300 WP_011275410.1 NZ_CP123979:1109117-1109266 [Staphylococcus haemolyticus]
MTKNKDSELNYHEEENAMVQDLDDLKTLGKEMEQISEENDEDKLNQSHE
MTKNKDSELNYHEEENAMVQDLDDLKTLGKEMEQISEENDEDKLNQSHE
Download Length: 150 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22272.12 Da Isoelectric Point: 4.7588
>AT279300 WP_011275409.1 NZ_CP123979:1108495-1109094 [Staphylococcus haemolyticus]
MAMNFKVFNDVEHVAEYTADIIRKQFNNNPTTIAGIHLTKDAAPVLDELKKDVDHNAVDFSQVNILDYDDNRSYYEALGV
PASQIYPINLDDDAESLIDDKIKTKENKGKLILQVTSIDESGSLNVNVRQGLLKAREVVLVVTGANKREVVKKLYEENGK
SSFEPSDLKAHRMVTVVLDRAAAEGLPEDVKEYFTARFA
MAMNFKVFNDVEHVAEYTADIIRKQFNNNPTTIAGIHLTKDAAPVLDELKKDVDHNAVDFSQVNILDYDDNRSYYEALGV
PASQIYPINLDDDAESLIDDKIKTKENKGKLILQVTSIDESGSLNVNVRQGLLKAREVVLVVTGANKREVVKKLYEENGK
SSFEPSDLKAHRMVTVVLDRAAAEGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|