Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 964398..964930 | Replicon | chromosome |
| Accession | NZ_CP123979 | ||
| Organism | Staphylococcus haemolyticus strain SH1275 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q4L7V3 |
| Locus tag | QHG38_RS04735 | Protein ID | WP_011275272.1 |
| Coordinates | 964565..964930 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | Q4L7V4 |
| Locus tag | QHG38_RS04730 | Protein ID | WP_011275271.1 |
| Coordinates | 964398..964568 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QHG38_RS04705 (QHG38_04705) | 960184..960663 | + | 480 | WP_049394640.1 | PH domain-containing protein | - |
| QHG38_RS04710 (QHG38_04710) | 960656..962179 | + | 1524 | WP_016931363.1 | PH domain-containing protein | - |
| QHG38_RS04715 (QHG38_04715) | 962172..962699 | + | 528 | WP_016931364.1 | PH domain-containing protein | - |
| QHG38_RS04720 (QHG38_04720) | 962709..963068 | + | 360 | WP_037559766.1 | holo-ACP synthase | - |
| QHG38_RS04725 (QHG38_04725) | 963164..964312 | + | 1149 | WP_240557223.1 | alanine racemase | - |
| QHG38_RS04730 (QHG38_04730) | 964398..964568 | + | 171 | WP_011275271.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QHG38_RS04735 (QHG38_04735) | 964565..964930 | + | 366 | WP_011275272.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QHG38_RS04740 (QHG38_04740) | 965238..966239 | + | 1002 | WP_011275273.1 | PP2C family protein-serine/threonine phosphatase | - |
| QHG38_RS04745 (QHG38_04745) | 966338..966664 | + | 327 | WP_011275274.1 | anti-sigma factor antagonist | - |
| QHG38_RS04750 (QHG38_04750) | 966693..967145 | + | 453 | WP_046309853.1 | anti-sigma B factor RsbW | - |
| QHG38_RS04755 (QHG38_04755) | 967120..967890 | + | 771 | WP_011275276.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 958657..959973 | 1316 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13672.75 Da Isoelectric Point: 8.4121
>T279299 WP_011275272.1 NZ_CP123979:964565-964930 [Staphylococcus haemolyticus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYRLDKDSVILLEQIR
TLDKKRLKEKLTYLSDEKMQEVDEALDISLGLHDEVKTQNT
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYRLDKDSVILLEQIR
TLDKKRLKEKLTYLSDEKMQEVDEALDISLGLHDEVKTQNT
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A1KA75 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A1K7K7 |