Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1327701..1328617 | Replicon | chromosome |
| Accession | NZ_CP123977 | ||
| Organism | Bacillus subtilis subsp. subtilis strain WH60A | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | QEP20_RS06975 | Protein ID | WP_003244695.1 |
| Coordinates | 1327871..1328617 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | QEP20_RS06970 | Protein ID | WP_003232646.1 |
| Coordinates | 1327701..1327871 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEP20_RS06935 (QEP20_06935) | 1324567..1324893 | + | 327 | WP_069703538.1 | XkdW family protein | - |
| QEP20_RS06940 (QEP20_06940) | 1324890..1325054 | + | 165 | WP_014479563.1 | XkdX family protein | - |
| QEP20_RS06945 (QEP20_06945) | 1325098..1325937 | + | 840 | WP_029727045.1 | phage-like element PBSX protein XepA | - |
| QEP20_RS06950 (QEP20_06950) | 1325990..1326259 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
| QEP20_RS06955 (QEP20_06955) | 1326272..1326535 | + | 264 | WP_014479566.1 | phage holin | - |
| QEP20_RS06960 (QEP20_06960) | 1326548..1327441 | + | 894 | WP_029727044.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QEP20_RS06965 (QEP20_06965) | 1327478..1327615 | - | 138 | WP_119899277.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| QEP20_RS06970 (QEP20_06970) | 1327701..1327871 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| QEP20_RS06975 (QEP20_06975) | 1327871..1328617 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| QEP20_RS06980 (QEP20_06980) | 1328727..1329728 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| QEP20_RS06985 (QEP20_06985) | 1329741..1330358 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| QEP20_RS06990 (QEP20_06990) | 1330634..1331950 | - | 1317 | WP_015252262.1 | serine/threonine exchanger | - |
| QEP20_RS06995 (QEP20_06995) | 1332339..1333289 | + | 951 | WP_014476561.1 | ring-cleaving dioxygenase | - |
| QEP20_RS07000 (QEP20_07000) | 1333398..1333493 | + | 96 | Protein_1315 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T279297 WP_003244695.1 NZ_CP123977:c1328617-1327871 [Bacillus subtilis subsp. subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|