Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 516647..517283 | Replicon | chromosome |
Accession | NZ_CP123977 | ||
Organism | Bacillus subtilis subsp. subtilis strain WH60A |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QEP20_RS02635 | Protein ID | WP_003156187.1 |
Coordinates | 516933..517283 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | QEP20_RS02630 | Protein ID | WP_003225183.1 |
Coordinates | 516647..516928 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEP20_RS02610 (QEP20_02610) | 513006..513605 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
QEP20_RS02615 (QEP20_02615) | 513700..514065 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
QEP20_RS02620 (QEP20_02620) | 514231..515247 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
QEP20_RS02625 (QEP20_02625) | 515362..516531 | + | 1170 | WP_003234284.1 | alanine racemase | - |
QEP20_RS02630 (QEP20_02630) | 516647..516928 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QEP20_RS02635 (QEP20_02635) | 516933..517283 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QEP20_RS02640 (QEP20_02640) | 517398..518222 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
QEP20_RS02645 (QEP20_02645) | 518227..518592 | + | 366 | WP_015715277.1 | RsbT antagonist protein RsbS | - |
QEP20_RS02650 (QEP20_02650) | 518596..518997 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
QEP20_RS02655 (QEP20_02655) | 519009..520016 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
QEP20_RS02660 (QEP20_02660) | 520078..520407 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
QEP20_RS02665 (QEP20_02665) | 520404..520886 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
QEP20_RS02670 (QEP20_02670) | 520852..521640 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
QEP20_RS02675 (QEP20_02675) | 521640..522239 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T279296 WP_003156187.1 NZ_CP123977:516933-517283 [Bacillus subtilis subsp. subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|