Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 148884..149540 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP123973 | ||
| Organism | Ligilactobacillus salivarius strain ZSA5 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | F5VFM3 |
| Locus tag | QFE45_RS11275 | Protein ID | WP_003706681.1 |
| Coordinates | 148884..149075 (+) | Length | 64 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QFE45_RS11280 | Protein ID | WP_003706680.1 |
| Coordinates | 149136..149540 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFE45_RS11245 (QFE45_11245) | 144643..145347 | + | 705 | WP_284650817.1 | Fic family protein | - |
| QFE45_RS11250 (QFE45_11250) | 146160..146933 | + | 774 | WP_284650819.1 | hypothetical protein | - |
| QFE45_RS11255 (QFE45_11255) | 147035..147451 | + | 417 | WP_284650843.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QFE45_RS11260 (QFE45_11260) | 147495..148271 | + | 777 | WP_284650821.1 | metallophosphoesterase | - |
| QFE45_RS11265 (QFE45_11265) | 148287..148502 | + | 216 | WP_284650823.1 | hypothetical protein | - |
| QFE45_RS11270 (QFE45_11270) | 148567..148833 | + | 267 | WP_284650825.1 | hypothetical protein | - |
| QFE45_RS11275 (QFE45_11275) | 148884..149075 | + | 192 | WP_003706681.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QFE45_RS11280 (QFE45_11280) | 149136..149540 | + | 405 | WP_003706680.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QFE45_RS11285 (QFE45_11285) | 150598..151770 | + | 1173 | WP_284650827.1 | hypothetical protein | - |
| QFE45_RS11290 (QFE45_11290) | 152016..152501 | + | 486 | WP_284650829.1 | hypothetical protein | - |
| QFE45_RS11295 (QFE45_11295) | 152520..152726 | + | 207 | WP_284650831.1 | hypothetical protein | - |
| QFE45_RS11300 (QFE45_11300) | 152753..153973 | + | 1221 | WP_284650833.1 | transposase | - |
| QFE45_RS11305 (QFE45_11305) | 154188..154526 | + | 339 | WP_086200837.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..166598 | 166598 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 64 a.a. Molecular weight: 7078.27 Da Isoelectric Point: 10.4059
>T279293 WP_003706681.1 NZ_CP123973:148884-149075 [Ligilactobacillus salivarius]
MPLTGKDMVKLLLDNGFVERRVNGSHHQLYKDGVRITVPIHGNQDLGKGLERKILKEAGIDKK
MPLTGKDMVKLLLDNGFVERRVNGSHHQLYKDGVRITVPIHGNQDLGKGLERKILKEAGIDKK
Download Length: 192 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14781.88 Da Isoelectric Point: 4.8837
>AT279293 WP_003706680.1 NZ_CP123973:149136-149540 [Ligilactobacillus salivarius]
MSNKQKMVVAYPAIFTPEENGGYLIEFPDIQGAFTGINNDDLGYGMEMASEVLGLTVADYLESGDDLSKPTAVNKVKHKE
GSFVTLVSTDVSKYLDNQKLVKKTLTIPKWANQKAIKENINFSALLTKAILDYN
MSNKQKMVVAYPAIFTPEENGGYLIEFPDIQGAFTGINNDDLGYGMEMASEVLGLTVADYLESGDDLSKPTAVNKVKHKE
GSFVTLVSTDVSKYLDNQKLVKKTLTIPKWANQKAIKENINFSALLTKAILDYN
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|