Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 249989..250601 | Replicon | chromosome |
| Accession | NZ_CP123969 | ||
| Organism | Streptococcus agalactiae strain CS2108 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A8G2N8L3 |
| Locus tag | QGO80_RS01435 | Protein ID | WP_000384860.1 |
| Coordinates | 249989..250324 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q8E7D2 |
| Locus tag | QGO80_RS01440 | Protein ID | WP_000259017.1 |
| Coordinates | 250314..250601 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QGO80_RS01410 (QGO80_01410) | 245178..245819 | + | 642 | WP_000591144.1 | hypothetical protein | - |
| QGO80_RS01415 (QGO80_01415) | 246119..246994 | + | 876 | WP_000421240.1 | hypothetical protein | - |
| QGO80_RS01420 (QGO80_01420) | 247030..247464 | + | 435 | WP_001220479.1 | hypothetical protein | - |
| QGO80_RS01425 (QGO80_01425) | 247781..249046 | + | 1266 | WP_281137013.1 | MobV family relaxase | - |
| QGO80_RS01430 (QGO80_01430) | 249214..249684 | + | 471 | WP_000130119.1 | hypothetical protein | - |
| QGO80_RS01435 (QGO80_01435) | 249989..250324 | - | 336 | WP_000384860.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QGO80_RS01440 (QGO80_01440) | 250314..250601 | - | 288 | WP_000259017.1 | hypothetical protein | Antitoxin |
| QGO80_RS01445 (QGO80_01445) | 251108..251398 | + | 291 | WP_000078283.1 | WXG100 family type VII secretion target | - |
| QGO80_RS01450 (QGO80_01450) | 251500..251907 | + | 408 | WP_000749954.1 | hypothetical protein | - |
| QGO80_RS01455 (QGO80_01455) | 251907..252467 | + | 561 | WP_001865562.1 | hypothetical protein | - |
| QGO80_RS01460 (QGO80_01460) | 252440..253120 | + | 681 | WP_001865565.1 | hypothetical protein | - |
| QGO80_RS01465 (QGO80_01465) | 253105..253491 | + | 387 | WP_000259069.1 | hypothetical protein | - |
| QGO80_RS01470 (QGO80_01470) | 253525..253806 | + | 282 | WP_000052406.1 | hypothetical protein | - |
| QGO80_RS01475 (QGO80_01475) | 254649..255509 | + | 861 | WP_000477654.1 | Rgg/GadR/MutR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13227.87 Da Isoelectric Point: 4.5348
>T279292 WP_000384860.1 NZ_CP123969:c250324-249989 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENSVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENSVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|