Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3453904..3454522 | Replicon | chromosome |
Accession | NZ_CP123963 | ||
Organism | Escherichia coli strain L6-21 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QC817_RS17000 | Protein ID | WP_001291435.1 |
Coordinates | 3454304..3454522 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QC817_RS16995 | Protein ID | WP_000344800.1 |
Coordinates | 3453904..3454278 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC817_RS16985 (3448993) | 3448993..3450186 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QC817_RS16990 (3450209) | 3450209..3453358 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QC817_RS16995 (3453904) | 3453904..3454278 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QC817_RS17000 (3454304) | 3454304..3454522 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QC817_RS17005 (3454694) | 3454694..3455245 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QC817_RS17010 (3455361) | 3455361..3455831 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QC817_RS17015 (3455995) | 3455995..3457545 | + | 1551 | WP_072645851.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QC817_RS17020 (3457587) | 3457587..3457940 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QC817_RS17030 (3458319) | 3458319..3458630 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QC817_RS17035 (3458661) | 3458661..3459233 | - | 573 | WP_281103610.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T279285 WP_001291435.1 NZ_CP123963:3454304-3454522 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT279285 WP_000344800.1 NZ_CP123963:3453904-3454278 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |