Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2261081..2261719 | Replicon | chromosome |
Accession | NZ_CP123963 | ||
Organism | Escherichia coli strain L6-21 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QC817_RS11075 | Protein ID | WP_000813794.1 |
Coordinates | 2261081..2261257 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QC817_RS11080 | Protein ID | WP_001270286.1 |
Coordinates | 2261303..2261719 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC817_RS11055 (2256700) | 2256700..2257875 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
QC817_RS11060 (2257967) | 2257967..2258503 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
QC817_RS11065 (2258576) | 2258576..2260537 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QC817_RS11070 (2260629) | 2260629..2260859 | - | 231 | WP_000494244.1 | YncJ family protein | - |
QC817_RS11075 (2261081) | 2261081..2261257 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QC817_RS11080 (2261303) | 2261303..2261719 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QC817_RS11085 (2261798) | 2261798..2263204 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
QC817_RS11090 (2263449) | 2263449..2264594 | + | 1146 | WP_000047418.1 | ABC transporter substrate-binding protein | - |
QC817_RS11095 (2264612) | 2264612..2265625 | + | 1014 | WP_000220393.1 | ABC transporter ATP-binding protein | - |
QC817_RS11100 (2265626) | 2265626..2266567 | + | 942 | WP_001251319.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T279283 WP_000813794.1 NZ_CP123963:2261081-2261257 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT279283 WP_001270286.1 NZ_CP123963:2261303-2261719 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|