Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 769050..769648 Replicon chromosome
Accession NZ_CP123963
Organism Escherichia coli strain L6-21

Toxin (Protein)


Gene name doc Uniprot ID A0A8T6PRV3
Locus tag QC817_RS03820 Protein ID WP_053291281.1
Coordinates 769271..769648 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID L4J1C0
Locus tag QC817_RS03815 Protein ID WP_001603498.1
Coordinates 769050..769271 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC817_RS03780 (764051) 764051..764588 + 538 Protein_741 IS1595 family transposase -
QC817_RS03785 (764852) 764852..766069 + 1218 WP_152950178.1 oligosaccharide flippase family protein -
QC817_RS03790 (766207) 766207..766593 - 387 Protein_743 antirestriction protein ArdA -
QC817_RS03795 (766920) 766920..767204 - 285 WP_008913927.1 hypothetical protein -
QC817_RS03800 (767460) 767460..767879 - 420 Protein_745 tyrosine-type recombinase/integrase -
QC817_RS03810 (768644) 768644..768865 + 222 Protein_747 fimbrial protein -
QC817_RS03815 (769050) 769050..769271 + 222 WP_001603498.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QC817_RS03820 (769271) 769271..769648 + 378 WP_053291281.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QC817_RS03825 (769758) 769758..769973 - 216 Protein_750 transposase -
QC817_RS03830 (770159) 770159..771421 - 1263 WP_089634553.1 integrase arm-type DNA-binding domain-containing protein -
QC817_RS03840 (771800) 771800..772507 - 708 WP_000234514.1 DUF554 domain-containing protein -
QC817_RS03845 (772660) 772660..772743 + 84 WP_211180506.1 protein YqgH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 747832..777626 29794
- inside IScluster/Tn - - 750229..769973 19744
- inside Prophage - - 763503..777626 14123


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13487.28 Da        Isoelectric Point: 6.2257

>T279272 WP_053291281.1 NZ_CP123963:769271-769648 [Escherichia coli]
MRHISPEELIAIHDANISRYGGLPGMPDSGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA

Download         Length: 378 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8190.24 Da        Isoelectric Point: 6.3159

>AT279272 WP_001603498.1 NZ_CP123963:769050-769271 [Escherichia coli]
MQSINFRTARSNLTEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDTTNKKLVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB L4J1C0

References