Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2592504..2593152 | Replicon | chromosome |
| Accession | NZ_CP123958 | ||
| Organism | Mannheimia haemolytica strain 190176 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A249A099 |
| Locus tag | QH638_RS13410 | Protein ID | WP_006251221.1 |
| Coordinates | 2592504..2592680 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A248ZZL6 |
| Locus tag | QH638_RS13415 | Protein ID | WP_006251222.1 |
| Coordinates | 2592736..2593152 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QH638_RS13390 | 2587822..2590317 | - | 2496 | WP_006251216.1 | phage tail length tape measure family protein | - |
| QH638_RS13395 | 2590862..2591320 | - | 459 | WP_006251218.1 | hypothetical protein | - |
| QH638_RS13400 | 2591489..2591722 | + | 234 | WP_020824316.1 | hypothetical protein | - |
| QH638_RS13405 | 2591737..2592402 | - | 666 | WP_015587050.1 | DUF6246 family protein | - |
| QH638_RS13410 | 2592504..2592680 | + | 177 | WP_006251221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QH638_RS13415 | 2592736..2593152 | + | 417 | WP_006251222.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QH638_RS13420 | 2593192..2593674 | - | 483 | WP_006251223.1 | phage tail tube protein | - |
| QH638_RS13425 | 2593678..2594058 | - | 381 | WP_006251224.1 | hypothetical protein | - |
| QH638_RS13430 | 2594055..2594423 | - | 369 | WP_006251225.1 | hypothetical protein | - |
| QH638_RS13435 | 2594425..2594769 | - | 345 | WP_006251226.1 | hypothetical protein | - |
| QH638_RS13440 | 2594769..2595146 | - | 378 | WP_006251227.1 | hypothetical protein | - |
| QH638_RS13445 | 2595149..2595409 | - | 261 | WP_020824317.1 | hypothetical protein | - |
| QH638_RS13450 | 2595421..2596410 | - | 990 | WP_006251229.1 | encapsulin | - |
| QH638_RS13455 | 2596425..2596859 | - | 435 | WP_006251230.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2575411..2655900 | 80489 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6640.79 Da Isoelectric Point: 10.7708
>T279268 WP_006251221.1 NZ_CP123958:2592504-2592680 [Mannheimia haemolytica]
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15519.91 Da Isoelectric Point: 4.3508
>AT279268 WP_006251222.1 NZ_CP123958:2592736-2593152 [Mannheimia haemolytica]
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A099 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZZL6 |