Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 195321..195860 Replicon chromosome
Accession NZ_CP123958
Organism Mannheimia haemolytica strain 190176

Toxin (Protein)


Gene name relE Uniprot ID A0A248ZYA9
Locus tag QH638_RS01065 Protein ID WP_006247804.1
Coordinates 195591..195860 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag QH638_RS01060 Protein ID WP_006247803.1
Coordinates 195321..195587 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QH638_RS01010 190721..191356 - 636 Protein_196 helix-turn-helix domain-containing protein -
QH638_RS01015 191457..192167 - 711 Protein_197 site-specific integrase -
QH638_RS01020 192071..192394 - 324 WP_006253316.1 helix-turn-helix domain-containing protein -
QH638_RS01025 192475..192642 - 168 WP_006253314.1 DNA cytosine methyltransferase -
QH638_RS01030 192650..193024 - 375 WP_006247798.1 hypothetical protein -
QH638_RS01035 193174..193401 + 228 Protein_201 phage terminase large subunit family protein -
QH638_RS01040 193426..193821 + 396 WP_006247799.1 phage tail terminator protein -
QH638_RS01045 193853..194494 + 642 WP_006247800.1 hypothetical protein -
QH638_RS01050 194577..194978 + 402 WP_006247801.1 hypothetical protein -
QH638_RS01055 195023..195253 + 231 WP_006247802.1 DUF4035 domain-containing protein -
QH638_RS01060 195321..195587 + 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QH638_RS01065 195591..195860 + 270 WP_006247804.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QH638_RS01070 195935..196198 + 264 WP_006247805.1 hypothetical protein -
QH638_RS01075 196258..196968 + 711 WP_006253312.1 tape measure protein -
QH638_RS01080 196946..197236 + 291 Protein_210 NlpC/P60 family protein -
QH638_RS01085 197226..197945 + 720 WP_006247806.1 preprotein translocase subunit YajC -
QH638_RS01090 198167..198793 + 627 WP_006247807.1 tail assembly protein -
QH638_RS01095 198842..199453 + 612 WP_006253310.1 hypothetical protein -
QH638_RS01100 199564..200250 + 687 WP_006247808.1 hypothetical protein -
QH638_RS01105 200260..200418 + 159 WP_006247809.1 hypothetical protein -
QH638_RS01110 200427..200726 - 300 WP_006247810.1 XRE family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 181414..206914 25500
- flank IS/Tn - - 190664..191356 692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10278.90 Da        Isoelectric Point: 6.2121

>T279260 WP_006247804.1 NZ_CP123958:195591-195860 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT279260 WP_006247803.1 NZ_CP123958:195321-195587 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248ZYA9

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References