Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2411211..2411847 | Replicon | chromosome |
Accession | NZ_CP123957 | ||
Organism | Pseudomonas marginalis strain MGMM3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QGQ83_RS11065 | Protein ID | WP_115487095.1 |
Coordinates | 2411443..2411847 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QGQ83_RS11060 | Protein ID | WP_115487096.1 |
Coordinates | 2411211..2411450 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QGQ83_RS11040 (QGQ83_11040) | 2406530..2407294 | - | 765 | WP_281113999.1 | amino acid ABC transporter ATP-binding protein | - |
QGQ83_RS11045 (QGQ83_11045) | 2407319..2408197 | - | 879 | WP_025859372.1 | amino acid ABC transporter permease | - |
QGQ83_RS11050 (QGQ83_11050) | 2408304..2409731 | - | 1428 | WP_281114000.1 | argininosuccinate lyase | - |
QGQ83_RS11055 (QGQ83_11055) | 2409925..2410884 | + | 960 | WP_281114001.1 | LysR family transcriptional regulator | - |
QGQ83_RS11060 (QGQ83_11060) | 2411211..2411450 | + | 240 | WP_115487096.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QGQ83_RS11065 (QGQ83_11065) | 2411443..2411847 | + | 405 | WP_115487095.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QGQ83_RS11070 (QGQ83_11070) | 2411878..2412525 | - | 648 | WP_057704184.1 | HAD-IB family hydrolase | - |
QGQ83_RS11075 (QGQ83_11075) | 2412599..2413312 | - | 714 | WP_281114002.1 | HNH endonuclease | - |
QGQ83_RS11080 (QGQ83_11080) | 2413509..2414759 | - | 1251 | WP_024077017.1 | ribonucleotide-diphosphate reductase subunit beta | - |
QGQ83_RS11085 (QGQ83_11085) | 2415270..2415539 | - | 270 | WP_027607759.1 | DUF2790 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15044.37 Da Isoelectric Point: 7.3571
>T279256 WP_115487095.1 NZ_CP123957:2411443-2411847 [Pseudomonas marginalis]
MIKYMLDTNIVIYIIKRRPIEILEKFNANVGRMVISSITLAELMHGAEKSQLVEKNTRAVEDFSSRLDVLNYDDKAAFHY
GSIRSDLEKKGTPIGVNDLHIAGHARSAGLVLVTNNECEFKRVNGLIVENWVAA
MIKYMLDTNIVIYIIKRRPIEILEKFNANVGRMVISSITLAELMHGAEKSQLVEKNTRAVEDFSSRLDVLNYDDKAAFHY
GSIRSDLEKKGTPIGVNDLHIAGHARSAGLVLVTNNECEFKRVNGLIVENWVAA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|