Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prcAT/RES-TIGR02293 |
Location | 5217651..5218534 | Replicon | chromosome |
Accession | NZ_CP123953 | ||
Organism | Pseudomonas aeruginosa strain 59 |
Toxin (Protein)
Gene name | PrcT | Uniprot ID | - |
Locus tag | P4N66_RS24920 | Protein ID | WP_231980891.1 |
Coordinates | 5217651..5218031 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | PrcA | Uniprot ID | S6AKX1 |
Locus tag | P4N66_RS24925 | Protein ID | WP_011078033.1 |
Coordinates | 5218085..5218534 (-) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4N66_RS24895 (P4N66_gene4946) | 5213127..5213345 | - | 219 | WP_254176716.1 | endonuclease | - |
P4N66_RS24900 (P4N66_gene4947) | 5213435..5214832 | - | 1398 | WP_047296850.1 | hypothetical protein | - |
P4N66_RS24905 (P4N66_gene4948) | 5214832..5215950 | - | 1119 | WP_011600754.1 | toxic anion resistance protein | - |
P4N66_RS24910 (P4N66_gene4949) | 5215961..5216734 | - | 774 | WP_011600753.1 | tellurite resistance protein | - |
P4N66_RS24915 (P4N66_gene4950) | 5216940..5217299 | - | 360 | WP_016502323.1 | hypothetical protein | - |
P4N66_RS24920 | 5217651..5218031 | - | 381 | WP_231980891.1 | RES family NAD+ phosphorylase | Toxin |
P4N66_RS24925 (P4N66_gene4951) | 5218085..5218534 | - | 450 | WP_011078033.1 | DUF2384 domain-containing protein | Antitoxin |
P4N66_RS24930 (P4N66_gene4952) | 5218950..5219273 | - | 324 | WP_047296954.1 | hypothetical protein | - |
P4N66_RS24935 (P4N66_gene4953) | 5219306..5219560 | - | 255 | WP_047296953.1 | hypothetical protein | - |
P4N66_RS24940 | 5219577..5219813 | - | 237 | WP_047296951.1 | hypothetical protein | - |
P4N66_RS24945 (P4N66_gene4955) | 5219825..5220259 | - | 435 | WP_047296950.1 | hypothetical protein | - |
P4N66_RS24950 (P4N66_gene4956) | 5220353..5221597 | - | 1245 | WP_172691824.1 | DUF1173 family protein | - |
P4N66_RS24955 (P4N66_gene4957) | 5221621..5222391 | - | 771 | WP_222236178.1 | hypothetical protein | - |
P4N66_RS24960 (P4N66_gene4958) | 5222837..5223283 | + | 447 | Protein_4942 | pyridoxal-phosphate dependent enzyme | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | sul1 / catB3 / blaOXA-1 / blaIMP-45 / mph(A) / aac(3)-IId | - | 5123644..5591374 | 467730 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13820.73 Da Isoelectric Point: 4.3068
>T279251 WP_231980891.1 NZ_CP123953:c5218031-5217651 [Pseudomonas aeruginosa]
VSGRWHQAGRPVVYTATSPPGAMLEVLVHLEIDPEDFPATMQLLRIEVPDSVSQAQMPTLPAGWSAETELTRGIGNQFLD
ECNALLLPVPSAIIPSTVNYLFNPRHPEAQSATIQVELFTPDSRLF
VSGRWHQAGRPVVYTATSPPGAMLEVLVHLEIDPEDFPATMQLLRIEVPDSVSQAQMPTLPAGWSAETELTRGIGNQFLD
ECNALLLPVPSAIIPSTVNYLFNPRHPEAQSATIQVELFTPDSRLF
Download Length: 381 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16963.45 Da Isoelectric Point: 6.1074
>AT279251 WP_011078033.1 NZ_CP123953:c5218534-5218085 [Pseudomonas aeruginosa]
MLAEVLRDHGYSAYRARLQILLEIPESASDFEIHTRISHGFSAARLMRLTEEGVVTPLERDQIIPLRTLKNRIERDQPLT
VEESDRLFRSAHITAMAEAIFGDADKAKRWLSKPKERFSGLTPMQLLTTQQGTSQVEEMLLQIAEGFAL
MLAEVLRDHGYSAYRARLQILLEIPESASDFEIHTRISHGFSAARLMRLTEEGVVTPLERDQIIPLRTLKNRIERDQPLT
VEESDRLFRSAHITAMAEAIFGDADKAKRWLSKPKERFSGLTPMQLLTTQQGTSQVEEMLLQIAEGFAL
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|