Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 2842124..2842710 | Replicon | chromosome |
Accession | NZ_CP123953 | ||
Organism | Pseudomonas aeruginosa strain 59 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | P4N66_RS13780 | Protein ID | WP_003120987.1 |
Coordinates | 2842124..2842423 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | P4N66_RS13785 | Protein ID | WP_003448662.1 |
Coordinates | 2842420..2842710 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4N66_RS13760 (P4N66_gene2743) | 2837237..2837770 | - | 534 | WP_023094340.1 | type IV pilus biogenesis protein PilP | - |
P4N66_RS13765 (P4N66_gene2744) | 2837760..2839085 | - | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
P4N66_RS13770 (P4N66_gene2745) | 2839089..2840798 | - | 1710 | WP_003123331.1 | PilN family type IVB pilus formation outer membrane protein | - |
P4N66_RS13775 (P4N66_gene2746) | 2840798..2841922 | - | 1125 | WP_023082046.1 | TcpQ domain-containing protein | - |
P4N66_RS13780 (P4N66_gene2747) | 2842124..2842423 | + | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P4N66_RS13785 (P4N66_gene2748) | 2842420..2842710 | + | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
P4N66_RS13790 (P4N66_gene2749) | 2842781..2843125 | - | 345 | WP_023082045.1 | hypothetical protein | - |
P4N66_RS13795 (P4N66_gene2750) | 2843264..2845240 | - | 1977 | WP_031691363.1 | DEAD/DEAH box helicase | - |
P4N66_RS13800 (P4N66_gene2751) | 2845237..2847126 | - | 1890 | WP_023101908.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2784022..2876777 | 92755 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T279248 WP_003120987.1 NZ_CP123953:2842124-2842423 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|