Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 625117..625754 | Replicon | chromosome |
| Accession | NZ_CP123953 | ||
| Organism | Pseudomonas aeruginosa strain 59 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | P4N66_RS02940 | Protein ID | WP_019725766.1 |
| Coordinates | 625117..625299 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | P4N66_RS02945 | Protein ID | WP_019725767.1 |
| Coordinates | 625332..625754 (+) | Length | 141 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4N66_RS02920 | 622099..622242 | + | 144 | WP_152959728.1 | hypothetical protein | - |
| P4N66_RS02925 (P4N66_gene0585) | 622569..622868 | - | 300 | WP_175597830.1 | nuclease-related domain-containing protein | - |
| P4N66_RS02930 (P4N66_gene0586) | 622997..624118 | - | 1122 | WP_003117952.1 | Fic family protein | - |
| P4N66_RS02935 | 624377..624514 | - | 138 | WP_003113217.1 | hypothetical protein | - |
| P4N66_RS02940 (P4N66_gene0588) | 625117..625299 | + | 183 | WP_019725766.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P4N66_RS02945 (P4N66_gene0589) | 625332..625754 | + | 423 | WP_019725767.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P4N66_RS02950 (P4N66_gene0591) | 626000..626971 | - | 972 | WP_025982283.1 | hypothetical protein | - |
| P4N66_RS02955 (P4N66_gene0592) | 626956..627648 | - | 693 | WP_019725770.1 | hypothetical protein | - |
| P4N66_RS02960 (P4N66_gene0593) | 627645..628187 | - | 543 | WP_025982284.1 | hypothetical protein | - |
| P4N66_RS02965 (P4N66_gene0594) | 628184..629107 | - | 924 | WP_019725772.1 | hypothetical protein | - |
| P4N66_RS02970 (P4N66_gene0595) | 629104..629580 | - | 477 | WP_019725773.1 | phage tail assembly chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 622997..676334 | 53337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6970.07 Da Isoelectric Point: 10.2954
>T279246 WP_019725766.1 NZ_CP123953:625117-625299 [Pseudomonas aeruginosa]
MKYSEFRRWLKARGVIFEPAKGSHFKVYYGDNQTIFPDHGAKEIGDGLRKKIIKDLGLKD
MKYSEFRRWLKARGVIFEPAKGSHFKVYYGDNQTIFPDHGAKEIGDGLRKKIIKDLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 14970.22 Da Isoelectric Point: 4.9047
>AT279246 WP_019725767.1 NZ_CP123953:625332-625754 [Pseudomonas aeruginosa]
MFDYPVTVHEEAGSVWVSCDDVPEMASAGDTVDEALLDAVEGLESALSLYVDRRQSIPLPSKGKAGQSIVRLPALTSAKI
ALWNTMLAQNVGKAELARRLGVNRVQVDRLVDLLHGSKIEAVEHALAILGQRLAVTVIAA
MFDYPVTVHEEAGSVWVSCDDVPEMASAGDTVDEALLDAVEGLESALSLYVDRRQSIPLPSKGKAGQSIVRLPALTSAKI
ALWNTMLAQNVGKAELARRLGVNRVQVDRLVDLLHGSKIEAVEHALAILGQRLAVTVIAA
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|