Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 143924..144429 | Replicon | chromosome |
| Accession | NZ_CP123953 | ||
| Organism | Pseudomonas aeruginosa strain 59 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | P4N66_RS00670 | Protein ID | WP_003083773.1 |
| Coordinates | 143924..144205 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | P4N66_RS00675 | Protein ID | WP_003083775.1 |
| Coordinates | 144202..144429 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4N66_RS00645 (P4N66_gene0125) | 139175..140524 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
| P4N66_RS00650 (P4N66_gene0126) | 140573..141259 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| P4N66_RS00655 (P4N66_gene0127) | 141360..142094 | + | 735 | WP_003101224.1 | GntR family transcriptional regulator | - |
| P4N66_RS00660 (P4N66_gene0128) | 142274..142684 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| P4N66_RS00665 (P4N66_gene0129) | 142716..143624 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| P4N66_RS00670 (P4N66_gene0130) | 143924..144205 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| P4N66_RS00675 (P4N66_gene0131) | 144202..144429 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| P4N66_RS00680 (P4N66_gene0132) | 144605..145225 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| P4N66_RS00685 (P4N66_gene0133) | 145326..145826 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| P4N66_RS00690 (P4N66_gene0134) | 145899..146240 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| P4N66_RS00695 (P4N66_gene0135) | 146322..147749 | - | 1428 | WP_003083784.1 | GABA permease | - |
| P4N66_RS00700 (P4N66_gene0136) | 147918..149411 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T279245 WP_003083773.1 NZ_CP123953:c144205-143924 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|