Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 3591485..3592123 | Replicon | chromosome |
Accession | NZ_CP123951 | ||
Organism | Escherichia coli strain TL012 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QGM68_RS17160 | Protein ID | WP_000813794.1 |
Coordinates | 3591947..3592123 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QGM68_RS17155 | Protein ID | WP_001270286.1 |
Coordinates | 3591485..3591901 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QGM68_RS17135 (3586637) | 3586637..3587578 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
QGM68_RS17140 (3587579) | 3587579..3588592 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
QGM68_RS17145 (3588610) | 3588610..3589755 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QGM68_RS17150 (3590000) | 3590000..3591406 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
QGM68_RS17155 (3591485) | 3591485..3591901 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QGM68_RS17160 (3591947) | 3591947..3592123 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QGM68_RS17165 (3592345) | 3592345..3592575 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QGM68_RS17170 (3592667) | 3592667..3594628 | - | 1962 | WP_001752477.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QGM68_RS17175 (3594701) | 3594701..3595237 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
QGM68_RS17180 (3595329) | 3595329..3596519 | + | 1191 | WP_001236269.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3596559..3597707 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T279243 WP_000813794.1 NZ_CP123951:c3592123-3591947 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT279243 WP_001270286.1 NZ_CP123951:c3591901-3591485 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|