Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2088499..2089153 | Replicon | chromosome |
Accession | NZ_CP123951 | ||
Organism | Escherichia coli strain TL012 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | QGM68_RS10085 | Protein ID | WP_000244777.1 |
Coordinates | 2088746..2089153 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QGM68_RS10080 | Protein ID | WP_000354046.1 |
Coordinates | 2088499..2088765 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QGM68_RS10060 (2084468) | 2084468..2085901 | - | 1434 | WP_001753034.1 | 6-phospho-beta-glucosidase BglA | - |
QGM68_RS10065 (2085946) | 2085946..2086257 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
QGM68_RS10070 (2086421) | 2086421..2087080 | + | 660 | WP_000250294.1 | hemolysin III family protein | - |
QGM68_RS10075 (2087276) | 2087276..2088256 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
QGM68_RS10080 (2088499) | 2088499..2088765 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QGM68_RS10085 (2088746) | 2088746..2089153 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
QGM68_RS10090 (2089193) | 2089193..2089714 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QGM68_RS10095 (2089826) | 2089826..2090722 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QGM68_RS10100 (2090747) | 2090747..2091457 | + | 711 | WP_001753033.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QGM68_RS10105 (2091463) | 2091463..2093196 | + | 1734 | WP_000813188.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T279233 WP_000244777.1 NZ_CP123951:2088746-2089153 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |