Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 5963333..5963849 | Replicon | chromosome |
Accession | NZ_CP123909 | ||
Organism | Pseudomonas atacamensis strain MGMM4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QG303_RS26925 | Protein ID | WP_122751862.1 |
Coordinates | 5963333..5963614 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2U1R4X8 |
Locus tag | QG303_RS26930 | Protein ID | WP_041477418.1 |
Coordinates | 5963604..5963849 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QG303_RS26905 (QG303_26905) | 5959392..5960279 | - | 888 | WP_016772263.1 | HlyD family secretion protein | - |
QG303_RS26910 (QG303_26910) | 5960276..5960485 | - | 210 | WP_016772264.1 | DUF1656 domain-containing protein | - |
QG303_RS26915 (QG303_26915) | 5960482..5962545 | - | 2064 | WP_133337580.1 | FUSC family protein | - |
QG303_RS26920 (QG303_26920) | 5962542..5962970 | - | 429 | WP_016772266.1 | winged helix DNA-binding protein | - |
QG303_RS26925 (QG303_26925) | 5963333..5963614 | - | 282 | WP_122751862.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QG303_RS26930 (QG303_26930) | 5963604..5963849 | - | 246 | WP_041477418.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QG303_RS26935 (QG303_26935) | 5963939..5964184 | - | 246 | WP_122705336.1 | DUF2789 domain-containing protein | - |
QG303_RS26940 (QG303_26940) | 5964263..5965828 | - | 1566 | WP_281120578.1 | efflux transporter outer membrane subunit | - |
QG303_RS26945 (QG303_26945) | 5965825..5966892 | - | 1068 | WP_281120579.1 | HlyD family secretion protein | - |
QG303_RS26950 (QG303_26950) | 5966920..5968458 | - | 1539 | WP_281120580.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10872.75 Da Isoelectric Point: 10.5812
>T279220 WP_122751862.1 NZ_CP123909:c5963614-5963333 [Pseudomonas atacamensis]
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHSMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERSSVYDTARNR
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHSMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERSSVYDTARNR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|