Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 5819667..5820295 | Replicon | chromosome |
Accession | NZ_CP123909 | ||
Organism | Pseudomonas atacamensis strain MGMM4 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QG303_RS26275 | Protein ID | WP_016772140.1 |
Coordinates | 5819897..5820295 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V8RDT4 |
Locus tag | QG303_RS26270 | Protein ID | WP_024011210.1 |
Coordinates | 5819667..5819897 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QG303_RS26245 (QG303_26245) | 5815875..5816219 | + | 345 | WP_024011214.1 | hypothetical protein | - |
QG303_RS26250 (QG303_26250) | 5816499..5817557 | + | 1059 | WP_281120532.1 | PDDEXK nuclease domain-containing protein | - |
QG303_RS26255 (QG303_26255) | 5817625..5818599 | + | 975 | WP_281120533.1 | alpha/beta fold hydrolase | - |
QG303_RS26260 (QG303_26260) | 5818629..5819042 | + | 414 | WP_125925799.1 | hypothetical protein | - |
QG303_RS26265 (QG303_26265) | 5819049..5819501 | + | 453 | WP_281120534.1 | hypothetical protein | - |
QG303_RS26270 (QG303_26270) | 5819667..5819897 | + | 231 | WP_024011210.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QG303_RS26275 (QG303_26275) | 5819897..5820295 | + | 399 | WP_016772140.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QG303_RS26280 (QG303_26280) | 5820374..5821765 | - | 1392 | WP_016772141.1 | GABA permease | - |
QG303_RS26285 (QG303_26285) | 5822309..5823082 | + | 774 | WP_024011209.1 | ABC transporter ATP-binding protein | - |
QG303_RS26290 (QG303_26290) | 5823096..5823848 | + | 753 | WP_130900469.1 | ABC transporter substrate-binding protein | - |
QG303_RS26295 (QG303_26295) | 5823926..5824621 | + | 696 | WP_281120535.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14547.92 Da Isoelectric Point: 7.1340
>T279219 WP_016772140.1 NZ_CP123909:5819897-5820295 [Pseudomonas atacamensis]
MIKYMLDTNICIFTIKNKPQIVREAFNRHSGQLCISAITLMELIYGAEKSAAPEKNLAIVEGFVARLDVLPFDNDAAAQA
GMVRSELAKAGTPIGPYDQMIAGHARSLGLIVVTNNVREFQRVSGLRIEDWV
MIKYMLDTNICIFTIKNKPQIVREAFNRHSGQLCISAITLMELIYGAEKSAAPEKNLAIVEGFVARLDVLPFDNDAAAQA
GMVRSELAKAGTPIGPYDQMIAGHARSLGLIVVTNNVREFQRVSGLRIEDWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|