Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 3925916..3926366 | Replicon | chromosome |
Accession | NZ_CP123909 | ||
Organism | Pseudomonas atacamensis strain MGMM4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QG303_RS17780 | Protein ID | WP_081489880.1 |
Coordinates | 3925916..3926185 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A341FF08 |
Locus tag | QG303_RS17785 | Protein ID | WP_038862015.1 |
Coordinates | 3926175..3926366 (-) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QG303_RS17760 (QG303_17760) | 3921503..3922126 | + | 624 | WP_016774080.1 | isochorismate family cysteine hydrolase YcaC | - |
QG303_RS17765 (QG303_17765) | 3922170..3923597 | - | 1428 | WP_073474277.1 | mechanosensitive ion channel family protein | - |
QG303_RS17770 (QG303_17770) | 3923706..3924728 | - | 1023 | WP_281119693.1 | alpha/beta hydrolase | - |
QG303_RS17775 (QG303_17775) | 3924944..3925843 | + | 900 | WP_024012435.1 | LysR family transcriptional regulator | - |
QG303_RS17780 (QG303_17780) | 3925916..3926185 | - | 270 | WP_081489880.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
QG303_RS17785 (QG303_17785) | 3926175..3926366 | - | 192 | WP_038862015.1 | hypothetical protein | Antitoxin |
QG303_RS17790 (QG303_17790) | 3926675..3927472 | + | 798 | WP_281119694.1 | class I SAM-dependent methyltransferase | - |
QG303_RS17795 (QG303_17795) | 3927589..3927897 | - | 309 | WP_281119695.1 | putative addiction module antidote protein | - |
QG303_RS17800 (QG303_17800) | 3928210..3928902 | - | 693 | WP_281119696.1 | N-acetyltransferase | - |
QG303_RS17805 (QG303_17805) | 3928899..3930089 | - | 1191 | WP_281119697.1 | GNAT family N-acetyltransferase | - |
QG303_RS17810 (QG303_17810) | 3930094..3930783 | - | 690 | WP_024012442.1 | GNAT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10249.64 Da Isoelectric Point: 7.3990
>T279214 WP_081489880.1 NZ_CP123909:c3926185-3925916 [Pseudomonas atacamensis]
MQIEWRPEAKADLSNILRYIGERNFAAAVSLSKSIEESTTSLSVHPHLYRKGRSPGTREIVVHPNYVVIYEVTDRVEILS
VLHTRQEYP
MQIEWRPEAKADLSNILRYIGERNFAAAVSLSKSIEESTTSLSVHPHLYRKGRSPGTREIVVHPNYVVIYEVTDRVEILS
VLHTRQEYP
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|