Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-CC2985 |
Location | 2599013..2599541 | Replicon | chromosome |
Accession | NZ_CP123909 | ||
Organism | Pseudomonas atacamensis strain MGMM4 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QG303_RS11890 | Protein ID | WP_281121329.1 |
Coordinates | 2599251..2599541 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A341F4V9 |
Locus tag | QG303_RS11885 | Protein ID | WP_016770738.1 |
Coordinates | 2599013..2599258 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QG303_RS11870 (QG303_11870) | 2595392..2595580 | + | 189 | WP_281121642.1 | hypothetical protein | - |
QG303_RS11875 (QG303_11875) | 2595815..2597851 | + | 2037 | WP_281121327.1 | Ig-like domain-containing protein | - |
QG303_RS11880 (QG303_11880) | 2598311..2598670 | + | 360 | WP_281121328.1 | hypothetical protein | - |
QG303_RS11885 (QG303_11885) | 2599013..2599258 | + | 246 | WP_016770738.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
QG303_RS11890 (QG303_11890) | 2599251..2599541 | + | 291 | WP_281121329.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QG303_RS11900 (QG303_11900) | 2599743..2601659 | - | 1917 | WP_281121520.1 | selenocysteine-specific translation elongation factor | - |
QG303_RS11905 (QG303_11905) | 2601656..2603068 | - | 1413 | WP_281121330.1 | L-seryl-tRNA(Sec) selenium transferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11068.63 Da Isoelectric Point: 7.2407
>T279212 WP_281121329.1 NZ_CP123909:2599251-2599541 [Pseudomonas atacamensis]
MAEYRLTPAAEADLEAIWTYTAQQWGLHQANRYIDILTASFEQLADRPKTAPACDAIRPGYRRCSVESHVIYFRITAYGI
AIIRILHDRMEAQRNL
MAEYRLTPAAEADLEAIWTYTAQQWGLHQANRYIDILTASFEQLADRPKTAPACDAIRPGYRRCSVESHVIYFRITAYGI
AIIRILHDRMEAQRNL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|