Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-CC2985 |
| Location | 2599013..2599541 | Replicon | chromosome |
| Accession | NZ_CP123909 | ||
| Organism | Pseudomonas atacamensis strain MGMM4 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | QG303_RS11890 | Protein ID | WP_281121329.1 |
| Coordinates | 2599251..2599541 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A341F4V9 |
| Locus tag | QG303_RS11885 | Protein ID | WP_016770738.1 |
| Coordinates | 2599013..2599258 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11068.63 Da Isoelectric Point: 7.2407
>T279212 WP_281121329.1 NZ_CP123909:2599251-2599541 [Pseudomonas atacamensis]
MAEYRLTPAAEADLEAIWTYTAQQWGLHQANRYIDILTASFEQLADRPKTAPACDAIRPGYRRCSVESHVIYFRITAYGI
AIIRILHDRMEAQRNL
MAEYRLTPAAEADLEAIWTYTAQQWGLHQANRYIDILTASFEQLADRPKTAPACDAIRPGYRRCSVESHVIYFRITAYGI
AIIRILHDRMEAQRNL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|