Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1261554..1262079 | Replicon | chromosome |
Accession | NZ_CP123909 | ||
Organism | Pseudomonas atacamensis strain MGMM4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A554AGI8 |
Locus tag | QG303_RS05820 | Protein ID | WP_041477706.1 |
Coordinates | 1261783..1262079 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A6I4K355 |
Locus tag | QG303_RS05815 | Protein ID | WP_039761862.1 |
Coordinates | 1261554..1261793 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QG303_RS05790 (QG303_05790) | 1257367..1257828 | + | 462 | WP_016773002.1 | GNAT family N-acetyltransferase | - |
QG303_RS05795 (QG303_05795) | 1258057..1258707 | + | 651 | WP_281120935.1 | DedA family protein | - |
QG303_RS05800 (QG303_05800) | 1258712..1259524 | + | 813 | WP_122610988.1 | zinc-dependent peptidase | - |
QG303_RS05805 (QG303_05805) | 1259637..1260164 | + | 528 | WP_003205933.1 | inorganic diphosphatase | - |
QG303_RS05810 (QG303_05810) | 1260382..1261128 | + | 747 | WP_073475694.1 | S24 family peptidase | - |
QG303_RS05815 (QG303_05815) | 1261554..1261793 | + | 240 | WP_039761862.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QG303_RS05820 (QG303_05820) | 1261783..1262079 | + | 297 | WP_041477706.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QG303_RS05825 (QG303_05825) | 1262228..1263313 | + | 1086 | WP_024014473.1 | macro domain-containing protein | - |
QG303_RS05830 (QG303_05830) | 1263359..1264171 | - | 813 | WP_110646086.1 | DUF2135 domain-containing protein | - |
QG303_RS05835 (QG303_05835) | 1264175..1265794 | - | 1620 | WP_281120937.1 | DUF2300 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11667.51 Da Isoelectric Point: 9.6904
>T279208 WP_041477706.1 NZ_CP123909:1261783-1262079 [Pseudomonas atacamensis]
MTYELEFDRRALKEWNKLGDTVRQQFKKKLAEVLENPRIEANRLRELPDCYKVKLKSAGYRLIYQVLDHEILVFVVAIGK
REREAAYEVAQDRLPSRT
MTYELEFDRRALKEWNKLGDTVRQQFKKKLAEVLENPRIEANRLRELPDCYKVKLKSAGYRLIYQVLDHEILVFVVAIGK
REREAAYEVAQDRLPSRT
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A554AGI8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6I4K355 |