Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
Location | 5451781..5452346 | Replicon | chromosome |
Accession | NZ_CP123897 | ||
Organism | Methylomonas sp. UP202 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QC632_RS24145 | Protein ID | WP_281021804.1 |
Coordinates | 5451781..5452122 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QC632_RS24150 | Protein ID | WP_281021805.1 |
Coordinates | 5452119..5452346 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC632_RS24115 (QC632_24115) | 5447246..5447806 | + | 561 | WP_281021798.1 | Uma2 family endonuclease | - |
QC632_RS24120 (QC632_24120) | 5447919..5448290 | + | 372 | WP_281021799.1 | DUF1640 domain-containing protein | - |
QC632_RS24125 (QC632_24125) | 5448385..5448837 | + | 453 | WP_281021800.1 | TerB family tellurite resistance protein | - |
QC632_RS24130 (QC632_24130) | 5448875..5449231 | + | 357 | WP_281021801.1 | hypothetical protein | - |
QC632_RS24135 (QC632_24135) | 5449590..5450420 | - | 831 | WP_281021802.1 | VPLPA-CTERM sorting domain-containing protein | - |
QC632_RS24140 (QC632_24140) | 5450513..5451127 | - | 615 | WP_281021803.1 | PEP-CTERM sorting domain-containing protein | - |
QC632_RS24145 (QC632_24145) | 5451781..5452122 | - | 342 | WP_281021804.1 | DUF5615 family PIN-like protein | Toxin |
QC632_RS24150 (QC632_24150) | 5452119..5452346 | - | 228 | WP_281021805.1 | DUF433 domain-containing protein | Antitoxin |
QC632_RS24155 (QC632_24155) | 5452966..5455131 | - | 2166 | WP_281021806.1 | zeta toxin family protein | - |
QC632_RS24160 (QC632_24160) | 5455311..5456129 | - | 819 | WP_281021807.1 | hypothetical protein | - |
QC632_RS24165 (QC632_24165) | 5456703..5456792 | - | 90 | Protein_4772 | twin-arginine translocase TatA/TatE family subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13063.09 Da Isoelectric Point: 4.6286
>T279205 WP_281021804.1 NZ_CP123897:c5452122-5451781 [Methylomonas sp. UP202]
MIFWVDAQLPPNLADWLRWTFKVEAYALRELGLRDANDLEIFERARQEGIVLISKDSDFVELILRQKPPPQLLWVTCGNT
TNQRLQALFNQVFPQALQLLAEGHMVVELADKS
MIFWVDAQLPPNLADWLRWTFKVEAYALRELGLRDANDLEIFERARQEGIVLISKDSDFVELILRQKPPPQLLWVTCGNT
TNQRLQALFNQVFPQALQLLAEGHMVVELADKS
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|