Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-StbC |
| Location | 4129354..4129996 | Replicon | chromosome |
| Accession | NZ_CP123897 | ||
| Organism | Methylomonas sp. UP202 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QC632_RS18320 | Protein ID | WP_281021063.1 |
| Coordinates | 4129354..4129773 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QC632_RS18325 | Protein ID | WP_082880795.1 |
| Coordinates | 4129760..4129996 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC632_RS18290 (QC632_18290) | 4124574..4124765 | + | 192 | WP_281021058.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| QC632_RS18295 (QC632_18295) | 4124765..4124938 | + | 174 | WP_281021059.1 | type II toxin-antitoxin system HicA family toxin | - |
| QC632_RS18300 (QC632_18300) | 4126295..4126609 | + | 315 | WP_281021060.1 | hypothetical protein | - |
| QC632_RS18305 (QC632_18305) | 4126622..4126909 | + | 288 | WP_281021061.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QC632_RS18310 (QC632_18310) | 4126897..4127247 | + | 351 | WP_281021062.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QC632_RS18315 (QC632_18315) | 4127323..4128983 | + | 1661 | Protein_3622 | IS66 family transposase | - |
| QC632_RS18320 (QC632_18320) | 4129354..4129773 | - | 420 | WP_281021063.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QC632_RS18325 (QC632_18325) | 4129760..4129996 | - | 237 | WP_082880795.1 | DNA-binding protein | Antitoxin |
| QC632_RS18330 (QC632_18330) | 4130489..4130800 | + | 312 | WP_281020173.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QC632_RS18335 (QC632_18335) | 4130788..4131138 | + | 351 | WP_033159537.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QC632_RS18340 (QC632_18340) | 4131305..4132837 | + | 1533 | WP_281023360.1 | IS66 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15820.23 Da Isoelectric Point: 6.2275
>T279202 WP_281021063.1 NZ_CP123897:c4129773-4129354 [Methylomonas sp. UP202]
MYLIDTNVISEIRKGDKANPGVRRFFDAAIQNNQKLYISVVTIGELRRGVDLIFHRDDIAQGKLLETWLNSILEHYQENI
LGIDCEIALIWGKMRVPNPQHPIDKLIAATALIYDLTVVTRNTEDFQNTGIALLNPFSK
MYLIDTNVISEIRKGDKANPGVRRFFDAAIQNNQKLYISVVTIGELRRGVDLIFHRDDIAQGKLLETWLNSILEHYQENI
LGIDCEIALIWGKMRVPNPQHPIDKLIAATALIYDLTVVTRNTEDFQNTGIALLNPFSK
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|