Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-StbC
Location 4129354..4129996 Replicon chromosome
Accession NZ_CP123897
Organism Methylomonas sp. UP202

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QC632_RS18320 Protein ID WP_281021063.1
Coordinates 4129354..4129773 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag QC632_RS18325 Protein ID WP_082880795.1
Coordinates 4129760..4129996 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC632_RS18290 (QC632_18290) 4124574..4124765 + 192 WP_281021058.1 type II toxin-antitoxin system HicB family antitoxin -
QC632_RS18295 (QC632_18295) 4124765..4124938 + 174 WP_281021059.1 type II toxin-antitoxin system HicA family toxin -
QC632_RS18300 (QC632_18300) 4126295..4126609 + 315 WP_281021060.1 hypothetical protein -
QC632_RS18305 (QC632_18305) 4126622..4126909 + 288 WP_281021061.1 IS66 family insertion sequence element accessory protein TnpB -
QC632_RS18310 (QC632_18310) 4126897..4127247 + 351 WP_281021062.1 IS66 family insertion sequence element accessory protein TnpB -
QC632_RS18315 (QC632_18315) 4127323..4128983 + 1661 Protein_3622 IS66 family transposase -
QC632_RS18320 (QC632_18320) 4129354..4129773 - 420 WP_281021063.1 type II toxin-antitoxin system VapC family toxin Toxin
QC632_RS18325 (QC632_18325) 4129760..4129996 - 237 WP_082880795.1 DNA-binding protein Antitoxin
QC632_RS18330 (QC632_18330) 4130489..4130800 + 312 WP_281020173.1 IS66 family insertion sequence element accessory protein TnpB -
QC632_RS18335 (QC632_18335) 4130788..4131138 + 351 WP_033159537.1 IS66 family insertion sequence element accessory protein TnpB -
QC632_RS18340 (QC632_18340) 4131305..4132837 + 1533 WP_281023360.1 IS66 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 15820.23 Da        Isoelectric Point: 6.2275

>T279202 WP_281021063.1 NZ_CP123897:c4129773-4129354 [Methylomonas sp. UP202]
MYLIDTNVISEIRKGDKANPGVRRFFDAAIQNNQKLYISVVTIGELRRGVDLIFHRDDIAQGKLLETWLNSILEHYQENI
LGIDCEIALIWGKMRVPNPQHPIDKLIAATALIYDLTVVTRNTEDFQNTGIALLNPFSK

Download         Length: 420 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8674.77 Da        Isoelectric Point: 5.5500

>AT279202 WP_082880795.1 NZ_CP123897:c4129996-4129760 [Methylomonas sp. UP202]
MPSLVVRNLDESIINALKARAVAHHRSTEAEHRAILAEFLLSPQRKTFAEALTNMPSVGIDTDFQRVNDDTPATNVFD

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References