Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 3347297..3347835 | Replicon | chromosome |
Accession | NZ_CP123897 | ||
Organism | Methylomonas sp. UP202 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QC632_RS14955 | Protein ID | WP_281020611.1 |
Coordinates | 3347539..3347835 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | QC632_RS14950 | Protein ID | WP_281020610.1 |
Coordinates | 3347297..3347542 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC632_RS14935 (QC632_14935) | 3344364..3345206 | - | 843 | WP_281020608.1 | hypothetical protein | - |
QC632_RS14940 (QC632_14940) | 3345312..3346091 | - | 780 | WP_281020609.1 | VPLPA-CTERM sorting domain-containing protein | - |
QC632_RS14945 (QC632_14945) | 3346578..3347135 | + | 558 | WP_071158132.1 | hypothetical protein | - |
QC632_RS14950 (QC632_14950) | 3347297..3347542 | + | 246 | WP_281020610.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
QC632_RS14955 (QC632_14955) | 3347539..3347835 | + | 297 | WP_281020611.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QC632_RS14960 (QC632_14960) | 3348021..3349730 | + | 1710 | WP_281020612.1 | hypothetical protein | - |
QC632_RS14965 (QC632_14965) | 3349872..3350216 | - | 345 | WP_281020613.1 | hypothetical protein | - |
QC632_RS14970 (QC632_14970) | 3350323..3351693 | - | 1371 | WP_281020614.1 | DUF6519 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11585.25 Da Isoelectric Point: 6.8684
>T279200 WP_281020611.1 NZ_CP123897:3347539-3347835 [Methylomonas sp. UP202]
MKPSYRIRQLAAEDLEHIWLYTFQQWGPEQADRYLRALFDRFTWLAEYPKLGKARDDIKPGYFCFPEGRHLVFYIATNTG
IEIIGVPHQNMDVINHVG
MKPSYRIRQLAAEDLEHIWLYTFQQWGPEQADRYLRALFDRFTWLAEYPKLGKARDDIKPGYFCFPEGRHLVFYIATNTG
IEIIGVPHQNMDVINHVG
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|