Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 3331373..3331954 | Replicon | chromosome |
Accession | NZ_CP123897 | ||
Organism | Methylomonas sp. UP202 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | QC632_RS14885 | Protein ID | WP_281020599.1 |
Coordinates | 3331655..3331954 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QC632_RS14880 | Protein ID | WP_281020598.1 |
Coordinates | 3331373..3331651 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC632_RS14855 (QC632_14855) | 3326749..3327600 | - | 852 | WP_281020593.1 | RNA polymerase sigma factor RpoH | - |
QC632_RS14860 (QC632_14860) | 3327842..3329503 | + | 1662 | WP_281020594.1 | glutamine--tRNA ligase/YqeY domain fusion protein | - |
QC632_RS14865 (QC632_14865) | 3329598..3330584 | + | 987 | WP_281020595.1 | toll/interleukin-1 receptor domain-containing protein | - |
QC632_RS14870 (QC632_14870) | 3330663..3330890 | + | 228 | WP_281020596.1 | addiction module protein | - |
QC632_RS14875 (QC632_14875) | 3330887..3331180 | + | 294 | WP_281020597.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QC632_RS14880 (QC632_14880) | 3331373..3331651 | - | 279 | WP_281020598.1 | putative addiction module antidote protein | Antitoxin |
QC632_RS14885 (QC632_14885) | 3331655..3331954 | - | 300 | WP_281020599.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QC632_RS14890 (QC632_14890) | 3332238..3332570 | + | 333 | WP_281020600.1 | hypothetical protein | - |
QC632_RS14895 (QC632_14895) | 3332690..3333247 | + | 558 | WP_281020601.1 | Uma2 family endonuclease | - |
QC632_RS14900 (QC632_14900) | 3333268..3334152 | + | 885 | WP_281020602.1 | fructosamine kinase family protein | - |
QC632_RS14905 (QC632_14905) | 3334246..3336894 | - | 2649 | WP_281020603.1 | EAL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3311582..3331954 | 20372 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11351.95 Da Isoelectric Point: 10.1005
>T279199 WP_281020599.1 NZ_CP123897:c3331954-3331655 [Methylomonas sp. UP202]
MKYELQSTQTFAEWFSRQKDKTVKNQLLSRLARIENGNFGDSKTLSANLFELRCFFGGGIRLYYTIRNQRIVLLLAGGDK
SSQNKDIEKAKAILNSLED
MKYELQSTQTFAEWFSRQKDKTVKNQLLSRLARIENGNFGDSKTLSANLFELRCFFGGGIRLYYTIRNQRIVLLLAGGDK
SSQNKDIEKAKAILNSLED
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|