Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpB-pemI/PRK09812-MazE |
Location | 2923179..2923771 | Replicon | chromosome |
Accession | NZ_CP123897 | ||
Organism | Methylomonas sp. UP202 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | - |
Locus tag | QC632_RS12725 | Protein ID | WP_281020266.1 |
Coordinates | 2923424..2923771 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | QC632_RS12720 | Protein ID | WP_281020265.1 |
Coordinates | 2923179..2923424 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC632_RS12700 (QC632_12700) | 2919116..2919331 | - | 216 | WP_281020261.1 | PRTRC system protein C | - |
QC632_RS12705 (QC632_12705) | 2919343..2919774 | - | 432 | WP_281020262.1 | PRTRC system protein E | - |
QC632_RS12710 (QC632_12710) | 2919777..2921717 | - | 1941 | WP_281020263.1 | PRTRC system ParB family protein | - |
QC632_RS12715 (QC632_12715) | 2921895..2922894 | + | 1000 | WP_281020264.1 | IS5 family transposase | - |
QC632_RS12720 (QC632_12720) | 2923179..2923424 | + | 246 | WP_281020265.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QC632_RS12725 (QC632_12725) | 2923424..2923771 | + | 348 | WP_281020266.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QC632_RS12730 (QC632_12730) | 2924286..2925161 | - | 876 | WP_256604544.1 | LysR family transcriptional regulator | - |
QC632_RS12735 (QC632_12735) | 2925281..2925607 | + | 327 | WP_033159460.1 | EthD family reductase | - |
QC632_RS12740 (QC632_12740) | 2925650..2926255 | + | 606 | WP_281020267.1 | hypothetical protein | - |
QC632_RS12745 (QC632_12745) | 2926301..2927194 | + | 894 | WP_281020268.1 | poly(3-hydroxybutyrate) depolymerase | - |
QC632_RS12750 (QC632_12750) | 2927559..2927918 | - | 360 | WP_281020269.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | groEL / htpB / htpB / tviB | 2808982..3217664 | 408682 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12381.27 Da Isoelectric Point: 9.2086
>T279198 WP_281020266.1 NZ_CP123897:2923424-2923771 [Methylomonas sp. UP202]
MAYLPNRGDIVHLAFHPSSGREMKGPHFGLVLSGKVFNQQGLAMICPISQGAAAAARTYGTVVTLSGAGTDTQGAVHCHQ
LKSLDWRARKVRLKETAPQQVVDEALARIEAILFE
MAYLPNRGDIVHLAFHPSSGREMKGPHFGLVLSGKVFNQQGLAMICPISQGAAAAARTYGTVVTLSGAGTDTQGAVHCHQ
LKSLDWRARKVRLKETAPQQVVDEALARIEAILFE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|