Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/- |
| Location | 2352849..2353438 | Replicon | chromosome |
| Accession | NZ_CP123897 | ||
| Organism | Methylomonas sp. UP202 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QC632_RS10240 | Protein ID | WP_281023112.1 |
| Coordinates | 2353055..2353438 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A172U6T4 |
| Locus tag | QC632_RS10235 | Protein ID | WP_064021136.1 |
| Coordinates | 2352849..2353058 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC632_RS10225 (QC632_10225) | 2349671..2351485 | + | 1815 | WP_281023110.1 | ABC transporter ATP-binding protein | - |
| QC632_RS10230 (QC632_10230) | 2352217..2352747 | + | 531 | WP_281023111.1 | transposase | - |
| QC632_RS10235 (QC632_10235) | 2352849..2353058 | + | 210 | WP_064021136.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QC632_RS10240 (QC632_10240) | 2353055..2353438 | + | 384 | WP_281023112.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QC632_RS10245 (QC632_10245) | 2353451..2353858 | + | 408 | WP_281023113.1 | transposase | - |
| QC632_RS10250 (QC632_10250) | 2354007..2355095 | - | 1089 | WP_281023115.1 | hypothetical protein | - |
| QC632_RS10255 (QC632_10255) | 2355331..2355726 | - | 396 | WP_281023116.1 | type II toxin-antitoxin system VapC family toxin | - |
| QC632_RS10260 (QC632_10260) | 2355723..2355989 | - | 267 | WP_197471828.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14069.34 Da Isoelectric Point: 5.6943
>T279196 WP_281023112.1 NZ_CP123897:2353055-2353438 [Methylomonas sp. UP202]
MILVDTSVWIDHFKNRNEDLVRLLVTDSALIHPLIVAELACGTPPAPRTQTLNNLRQLRCCNQAGLQEVEDFIEREALYG
LGCGLIDLQLLASVLITPGAKLWTLDKRLAKLAERFGVAYQASPTTN
MILVDTSVWIDHFKNRNEDLVRLLVTDSALIHPLIVAELACGTPPAPRTQTLNNLRQLRCCNQAGLQEVEDFIEREALYG
LGCGLIDLQLLASVLITPGAKLWTLDKRLAKLAERFGVAYQASPTTN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|