Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
| Location | 1391443..1392266 | Replicon | chromosome |
| Accession | NZ_CP123897 | ||
| Organism | Methylomonas sp. UP202 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | QC632_RS06085 | Protein ID | WP_281022560.1 |
| Coordinates | 1391730..1392266 (+) | Length | 179 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A177P7Z8 |
| Locus tag | QC632_RS06080 | Protein ID | WP_064024751.1 |
| Coordinates | 1391443..1391730 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC632_RS06070 (QC632_06070) | 1388106..1389446 | + | 1341 | WP_281023372.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
| QC632_RS06075 (QC632_06075) | 1389566..1391308 | + | 1743 | WP_281022559.1 | class I SAM-dependent DNA methyltransferase | - |
| QC632_RS06080 (QC632_06080) | 1391443..1391730 | + | 288 | WP_064024751.1 | DUF1778 domain-containing protein | Antitoxin |
| QC632_RS06085 (QC632_06085) | 1391730..1392266 | + | 537 | WP_281022560.1 | GNAT family N-acetyltransferase | Toxin |
| QC632_RS06090 (QC632_06090) | 1392263..1393540 | + | 1278 | WP_281022561.1 | restriction endonuclease subunit S | - |
| QC632_RS06095 (QC632_06095) | 1393537..1394172 | + | 636 | WP_281022562.1 | hypothetical protein | - |
| QC632_RS06100 (QC632_06100) | 1394437..1394673 | + | 237 | WP_281022563.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| QC632_RS06105 (QC632_06105) | 1394661..1394975 | + | 315 | WP_281022564.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| QC632_RS06110 (QC632_06110) | 1395262..1395525 | + | 264 | WP_281022565.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 179 a.a. Molecular weight: 19299.32 Da Isoelectric Point: 9.1795
>T279195 WP_281022560.1 NZ_CP123897:1391730-1392266 [Methylomonas sp. UP202]
VLSSPTLLTAEHRRHDFACGVDALDDWLKRRALSNQFSGASRTYVVTDESRVVGYYCLASGAMALNQALPALKRNMPDPV
PMAILCRLAVDFAWRGRGLGVALLQDAVLRTLRAASIVGIRGLLVHALSEPAKAFYQHHGFVASPTQPMTLILSLKHPLN
PATTETSADQQLIKDGPT
VLSSPTLLTAEHRRHDFACGVDALDDWLKRRALSNQFSGASRTYVVTDESRVVGYYCLASGAMALNQALPALKRNMPDPV
PMAILCRLAVDFAWRGRGLGVALLQDAVLRTLRAASIVGIRGLLVHALSEPAKAFYQHHGFVASPTQPMTLILSLKHPLN
PATTETSADQQLIKDGPT
Download Length: 537 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|