Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumAB/upstrm_HI1419-dnstrm_HI1420
Location 1002489..1003108 Replicon chromosome
Accession NZ_CP123897
Organism Methylomonas sp. UP202

Toxin (Protein)


Gene name PumA Uniprot ID A0A177NUT3
Locus tag QC632_RS04455 Protein ID WP_064026859.1
Coordinates 1002800..1003108 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID -
Locus tag QC632_RS04450 Protein ID WP_281022366.1
Coordinates 1002489..1002803 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC632_RS04415 (QC632_04415) 997622..998314 - 693 WP_071155258.1 leucyl/phenylalanyl-tRNA--protein transferase -
QC632_RS04420 (QC632_04420) 998441..998782 - 342 WP_064026847.1 hypothetical protein -
QC632_RS04425 (QC632_04425) 999065..999685 - 621 WP_064026849.1 urease accessory protein UreG -
QC632_RS04430 (QC632_04430) 999991..1000665 - 675 WP_281022362.1 urease accessory UreF family protein -
QC632_RS04435 (QC632_04435) 1000655..1001086 - 432 WP_281022363.1 urease accessory protein UreE -
QC632_RS04440 (QC632_04440) 1001233..1001418 - 186 WP_281022364.1 hypothetical protein -
QC632_RS04445 (QC632_04445) 1001644..1002315 - 672 WP_281022365.1 alpha/beta fold hydrolase -
QC632_RS04450 (QC632_04450) 1002489..1002803 - 315 WP_281022366.1 putative addiction module antidote protein Antitoxin
QC632_RS04455 (QC632_04455) 1002800..1003108 - 309 WP_064026859.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QC632_RS04460 (QC632_04460) 1003180..1003488 - 309 WP_281022367.1 CcdB family protein -
QC632_RS04465 (QC632_04465) 1003490..1003768 - 279 WP_281022368.1 type II toxin-antitoxin system CcdA family antitoxin -
QC632_RS04470 (QC632_04470) 1003868..1005400 - 1533 WP_281023365.1 IS66 family transposase -
QC632_RS04475 (QC632_04475) 1005567..1005917 - 351 WP_281021094.1 IS66 family insertion sequence element accessory protein TnpB -
QC632_RS04480 (QC632_04480) 1005905..1006216 - 312 WP_281020173.1 IS66 family insertion sequence element accessory protein TnpB -
QC632_RS04485 (QC632_04485) 1006986..1007342 + 357 WP_168032017.1 hypothetical protein -
QC632_RS04490 (QC632_04490) 1007428..1007994 + 567 WP_168032015.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(13-98)

Antitoxin

Uncharacterized protein HI1420

(3-95)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11502.02 Da        Isoelectric Point: 8.0184

>T279193 WP_064026859.1 NZ_CP123897:c1003108-1002800 [Methylomonas sp. UP202]
VKTVLTTELFDHWFTGLKDIQAKRRIQMRIDRAEDGHFGDCKPVGEGVSEMRVNTGPGYRIYYTQRGDGYEIVVLLAGGD
KSSQAQDIKTAIQLARQIKEQS

Download         Length: 309 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 11409.90 Da        Isoelectric Point: 5.1456

>AT279193 WP_281022366.1 NZ_CP123897:c1002803-1002489 [Methylomonas sp. UP202]
MTIKLKRWDSAEHLQTDEDIELYLQACFEEAGDDAAFIAKALGNVARARSMTQLAKDTGMGRESLYKALSGEGNPSFGTI
LKVTNALGLKFNVHLSDDSDRKMA

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A177NUT3

Antitoxin

Source ID Structure

References