Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1002489..1003108 | Replicon | chromosome |
| Accession | NZ_CP123897 | ||
| Organism | Methylomonas sp. UP202 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A177NUT3 |
| Locus tag | QC632_RS04455 | Protein ID | WP_064026859.1 |
| Coordinates | 1002800..1003108 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | QC632_RS04450 | Protein ID | WP_281022366.1 |
| Coordinates | 1002489..1002803 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC632_RS04415 (QC632_04415) | 997622..998314 | - | 693 | WP_071155258.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
| QC632_RS04420 (QC632_04420) | 998441..998782 | - | 342 | WP_064026847.1 | hypothetical protein | - |
| QC632_RS04425 (QC632_04425) | 999065..999685 | - | 621 | WP_064026849.1 | urease accessory protein UreG | - |
| QC632_RS04430 (QC632_04430) | 999991..1000665 | - | 675 | WP_281022362.1 | urease accessory UreF family protein | - |
| QC632_RS04435 (QC632_04435) | 1000655..1001086 | - | 432 | WP_281022363.1 | urease accessory protein UreE | - |
| QC632_RS04440 (QC632_04440) | 1001233..1001418 | - | 186 | WP_281022364.1 | hypothetical protein | - |
| QC632_RS04445 (QC632_04445) | 1001644..1002315 | - | 672 | WP_281022365.1 | alpha/beta fold hydrolase | - |
| QC632_RS04450 (QC632_04450) | 1002489..1002803 | - | 315 | WP_281022366.1 | putative addiction module antidote protein | Antitoxin |
| QC632_RS04455 (QC632_04455) | 1002800..1003108 | - | 309 | WP_064026859.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QC632_RS04460 (QC632_04460) | 1003180..1003488 | - | 309 | WP_281022367.1 | CcdB family protein | - |
| QC632_RS04465 (QC632_04465) | 1003490..1003768 | - | 279 | WP_281022368.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
| QC632_RS04470 (QC632_04470) | 1003868..1005400 | - | 1533 | WP_281023365.1 | IS66 family transposase | - |
| QC632_RS04475 (QC632_04475) | 1005567..1005917 | - | 351 | WP_281021094.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QC632_RS04480 (QC632_04480) | 1005905..1006216 | - | 312 | WP_281020173.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QC632_RS04485 (QC632_04485) | 1006986..1007342 | + | 357 | WP_168032017.1 | hypothetical protein | - |
| QC632_RS04490 (QC632_04490) | 1007428..1007994 | + | 567 | WP_168032015.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11502.02 Da Isoelectric Point: 8.0184
>T279193 WP_064026859.1 NZ_CP123897:c1003108-1002800 [Methylomonas sp. UP202]
VKTVLTTELFDHWFTGLKDIQAKRRIQMRIDRAEDGHFGDCKPVGEGVSEMRVNTGPGYRIYYTQRGDGYEIVVLLAGGD
KSSQAQDIKTAIQLARQIKEQS
VKTVLTTELFDHWFTGLKDIQAKRRIQMRIDRAEDGHFGDCKPVGEGVSEMRVNTGPGYRIYYTQRGDGYEIVVLLAGGD
KSSQAQDIKTAIQLARQIKEQS
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|