Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-hicB/-
Location 694118..694632 Replicon chromosome
Accession NZ_CP123897
Organism Methylomonas sp. UP202

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QC632_RS03040 Protein ID WP_281022197.1
Coordinates 694432..694632 (-) Length 67 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag QC632_RS03035 Protein ID WP_281022196.1
Coordinates 694118..694291 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC632_RS03010 (QC632_03010) 689668..691536 - 1869 WP_281022194.1 thiamine pyrophosphate-binding protein -
QC632_RS03015 (QC632_03015) 692101..692499 - 399 WP_071155851.1 DUF805 domain-containing protein -
QC632_RS03020 (QC632_03020) 692672..693052 + 381 WP_064031599.1 lipocalin family protein -
QC632_RS03025 (QC632_03025) 693181..693867 - 687 WP_281022195.1 FRG domain-containing protein -
QC632_RS03030 (QC632_03030) 693959..694111 - 153 WP_281023361.1 toxin-antitoxin system HicB family antitoxin -
QC632_RS03035 (QC632_03035) 694118..694291 - 174 WP_281022196.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QC632_RS03040 (QC632_03040) 694432..694632 - 201 WP_281022197.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QC632_RS03045 (QC632_03045) 694626..694814 - 189 WP_281022198.1 hypothetical protein -
QC632_RS03050 (QC632_03050) 694836..698279 - 3444 WP_281022199.1 transcription-repair coupling factor -
QC632_RS03055 (QC632_03055) 698455..699201 - 747 WP_071155857.1 flagellar brake protein -
QC632_RS03060 (QC632_03060) 699281..699601 + 321 WP_064031592.1 multidrug efflux SMR transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-62)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 67 a.a.        Molecular weight: 7643.88 Da        Isoelectric Point: 8.5908

>T279192 WP_281022197.1 NZ_CP123897:c694632-694432 [Methylomonas sp. UP202]
MVIWTPRARTDLKAIHDYIAQDSPLTAKRIIRELIQKTDSLLVSPYLGKKVPEFEQQELREIGVHS

Download         Length: 201 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6487.19 Da        Isoelectric Point: 4.0914

>AT279192 WP_281022196.1 NZ_CP123897:c694291-694118 [Methylomonas sp. UP202]
MNSMTYKGYTARIDFDDRNNLLVGRLLGVQDVIGFHADTVTELRSAFEEAVDDYLET

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References