Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 619585..620224 | Replicon | chromosome |
Accession | NZ_CP123897 | ||
Organism | Methylomonas sp. UP202 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QC632_RS02770 | Protein ID | WP_281022158.1 |
Coordinates | 619823..620224 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QC632_RS02765 | Protein ID | WP_281022157.1 |
Coordinates | 619585..619818 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC632_RS02755 (QC632_02755) | 615030..616142 | - | 1113 | WP_281022155.1 | ribonucleotide-diphosphate reductase subunit beta | - |
QC632_RS02760 (QC632_02760) | 616139..619018 | - | 2880 | WP_281022156.1 | ribonucleoside-diphosphate reductase subunit alpha | - |
QC632_RS02765 (QC632_02765) | 619585..619818 | + | 234 | WP_281022157.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QC632_RS02770 (QC632_02770) | 619823..620224 | + | 402 | WP_281022158.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QC632_RS02775 (QC632_02775) | 620926..621192 | + | 267 | WP_071154930.1 | DUF2281 domain-containing protein | - |
QC632_RS02780 (QC632_02780) | 621192..621575 | + | 384 | WP_281022159.1 | type II toxin-antitoxin system VapC family toxin | - |
QC632_RS02785 (QC632_02785) | 622514..623440 | + | 927 | WP_281022160.1 | hypothetical protein | - |
QC632_RS02790 (QC632_02790) | 623437..624024 | + | 588 | WP_281022161.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15010.41 Da Isoelectric Point: 7.5181
>T279191 WP_281022158.1 NZ_CP123897:619823-620224 [Methylomonas sp. UP202]
MLKYLLDTNIVIYVIKRRPIEVLATFNRHHGRMAISAVTLAELIHGAEKSQFPERNLATVEDFCSRLQVLPYNDSAAMHY
GGIRAALEKIGQPIGVNDLHIAAHARSHGLILVSNNLREFERVPGLLMENWLE
MLKYLLDTNIVIYVIKRRPIEVLATFNRHHGRMAISAVTLAELIHGAEKSQFPERNLATVEDFCSRLQVLPYNDSAAMHY
GGIRAALEKIGQPIGVNDLHIAAHARSHGLILVSNNLREFERVPGLLMENWLE
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|