Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 2256927..2257580 | Replicon | chromosome |
| Accession | NZ_CP123854 | ||
| Organism | Acinetobacter baumannii strain WB4 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | QG728_RS10885 | Protein ID | WP_025467596.1 |
| Coordinates | 2257191..2257580 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | QG728_RS10880 | Protein ID | WP_001288210.1 |
| Coordinates | 2256927..2257184 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QG728_RS10860 (QG728_10860) | 2252450..2253457 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| QG728_RS10865 (QG728_10865) | 2253476..2253853 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| QG728_RS10870 (QG728_10870) | 2254028..2255518 | + | 1491 | WP_000415138.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| QG728_RS10875 (QG728_10875) | 2255567..2256739 | - | 1173 | WP_262094012.1 | acyl-CoA dehydrogenase family protein | - |
| QG728_RS10880 (QG728_10880) | 2256927..2257184 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| QG728_RS10885 (QG728_10885) | 2257191..2257580 | + | 390 | WP_025467596.1 | membrane protein | Toxin |
| QG728_RS10890 (QG728_10890) | 2258350..2259435 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| QG728_RS10895 (QG728_10895) | 2259513..2260079 | + | 567 | WP_000651536.1 | rhombosortase | - |
| QG728_RS10900 (QG728_10900) | 2260267..2262462 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15609.84 Da Isoelectric Point: 10.3816
>T279190 WP_025467596.1 NZ_CP123854:2257191-2257580 [Acinetobacter baumannii]
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|