Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2691798..2692327 | Replicon | chromosome |
| Accession | NZ_CP123853 | ||
| Organism | Staphylococcus aureus strain FDA209P | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NUG19_RS13275 | Protein ID | WP_000621175.1 |
| Coordinates | 2691965..2692327 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NUG19_RS13270 | Protein ID | WP_000948331.1 |
| Coordinates | 2691798..2691968 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG19_RS13240 (2686834) | 2686834..2687394 | + | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
| NUG19_RS13245 (2687603) | 2687603..2688082 | + | 480 | WP_001287079.1 | hypothetical protein | - |
| NUG19_RS13250 (2688075) | 2688075..2689658 | + | 1584 | WP_001294620.1 | PH domain-containing protein | - |
| NUG19_RS13255 (2689645) | 2689645..2690136 | + | 492 | WP_001205912.1 | PH domain-containing protein | - |
| NUG19_RS13260 (2690140) | 2690140..2690499 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
| NUG19_RS13265 (2690565) | 2690565..2691713 | + | 1149 | WP_001281154.1 | alanine racemase | - |
| NUG19_RS13270 (2691798) | 2691798..2691968 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NUG19_RS13275 (2691965) | 2691965..2692327 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NUG19_RS13280 (2692677) | 2692677..2693678 | + | 1002 | WP_042727554.1 | PP2C family protein-serine/threonine phosphatase | - |
| NUG19_RS13285 (2693797) | 2693797..2694123 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NUG19_RS13290 (2694125) | 2694125..2694604 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NUG19_RS13295 (2694579) | 2694579..2695349 | + | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T279189 WP_000621175.1 NZ_CP123853:2691965-2692327 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|