Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1191226..1191703 Replicon chromosome
Accession NZ_CP123853
Organism Staphylococcus aureus strain FDA209P

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NUG19_RS05975 Protein ID WP_000052076.1
Coordinates 1191515..1191703 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NUG19_RS05970 Protein ID WP_001059690.1
Coordinates 1191226..1191486 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUG19_RS05935 (1186619) 1186619..1187335 - 717 WP_000150013.1 type I 3-dehydroquinate dehydratase -
NUG19_RS05940 (1187483) 1187483..1187905 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
NUG19_RS05945 (1188304) 1188304..1188798 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
NUG19_RS05950 (1188953) 1188953..1189570 + 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
NUG19_RS05955 (1189643) 1189643..1190224 - 582 WP_001140697.1 histidine phosphatase family protein -
NUG19_RS05960 (1190449) 1190449..1190685 + 237 WP_000368687.1 hypothetical protein -
NUG19_RS05965 (1190682) 1190682..1190885 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NUG19_RS05970 (1191226) 1191226..1191486 + 261 WP_001059690.1 hypothetical protein Antitoxin
NUG19_RS05975 (1191515) 1191515..1191703 + 189 WP_000052076.1 hypothetical protein Toxin
NUG19_RS05980 (1191891) 1191891..1192460 + 570 WP_001106653.1 lipoprotein N-acylation protein LnsA -
NUG19_RS05985 (1192548) 1192548..1192832 + 285 WP_001004394.1 hypothetical protein -
NUG19_RS05990 (1192894) 1192894..1193112 + 219 WP_000005884.1 hypothetical protein -
NUG19_RS05995 (1193607) 1193607..1193807 - 201 WP_001059082.1 cold-shock protein -
NUG19_RS06000 (1194164) 1194164..1194850 - 687 WP_001548082.1 thermonuclease family protein -
NUG19_RS06005 (1195191) 1195191..1195661 - 471 WP_000824472.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selq / selk / vWbp / clfA 1164626..1209580 44954
- inside Prophage - selq / selk / vWbp / clfA 1164626..1205400 40774


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T279184 WP_000052076.1 NZ_CP123853:1191515-1191703 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT279184 WP_001059690.1 NZ_CP123853:1191226-1191486 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References