Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 1173887..1174419 Replicon chromosome
Accession NZ_CP123853
Organism Staphylococcus aureus strain FDA209P

Toxin (Protein)


Gene name TscT Uniprot ID Q8VLW9
Locus tag NUG19_RS05840 Protein ID WP_001103944.1
Coordinates 1173887..1174207 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag NUG19_RS05845 Protein ID WP_001058492.1
Coordinates 1174210..1174419 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUG19_RS05810 (1168974) 1168974..1169315 - 342 WP_042727540.1 hypothetical protein -
NUG19_RS05815 (1169889) 1169889..1170530 - 642 WP_042727541.1 pathogenicity island protein -
NUG19_RS05820 (1170527) 1170527..1170811 - 285 WP_042727542.1 hypothetical protein -
NUG19_RS05825 (1170813) 1170813..1171175 - 363 WP_042727543.1 hypothetical protein -
NUG19_RS05830 (1171477) 1171477..1172934 - 1458 WP_042727544.1 virulence-associated E family protein -
NUG19_RS05835 (1172951) 1172951..1173820 - 870 WP_042727545.1 primase alpha helix C-terminal domain-containing protein -
NUG19_RS05840 (1173887) 1173887..1174207 - 321 WP_001103944.1 DUF1474 family protein Toxin
NUG19_RS05845 (1174210) 1174210..1174419 - 210 WP_001058492.1 hypothetical protein Antitoxin
NUG19_RS05850 (1174412) 1174412..1174558 - 147 WP_012990927.1 hypothetical protein -
NUG19_RS05855 (1174570) 1174570..1174842 - 273 WP_001138298.1 helix-turn-helix domain-containing protein -
NUG19_RS05860 (1174843) 1174843..1175055 - 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
NUG19_RS05865 (1175205) 1175205..1175939 + 735 WP_000142630.1 helix-turn-helix transcriptional regulator -
NUG19_RS05870 (1176114) 1176114..1176842 + 729 WP_001033317.1 staphylococcal enterotoxin type Q -
NUG19_RS05875 (1176866) 1176866..1177594 + 729 WP_042727546.1 staphylococcal enterotoxin type K -
NUG19_RS05880 (1177682) 1177682..1178902 + 1221 WP_000264181.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selq / selk / vWbp / clfA 1164626..1209580 44954
- inside Prophage - selq / selk / vWbp / clfA 1164626..1205400 40774


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-90)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12636.31 Da        Isoelectric Point: 4.8519

>T279183 WP_001103944.1 NZ_CP123853:c1174207-1173887 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDAKKLKITE

Download         Length: 321 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT279183 WP_001058492.1 NZ_CP123853:c1174419-1174210 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q8VLW9

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References