Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1191225..1191702 Replicon chromosome
Accession NZ_CP123852
Organism Staphylococcus aureus strain 5812R

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NRK31_RS05975 Protein ID WP_000052076.1
Coordinates 1191514..1191702 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NRK31_RS05970 Protein ID WP_001059690.1
Coordinates 1191225..1191485 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NRK31_RS05935 (1186618) 1186618..1187334 - 717 WP_000150013.1 type I 3-dehydroquinate dehydratase -
NRK31_RS05940 (1187482) 1187482..1187904 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
NRK31_RS05945 (1188303) 1188303..1188797 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
NRK31_RS05950 (1188952) 1188952..1189569 + 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
NRK31_RS05955 (1189642) 1189642..1190223 - 582 WP_001140697.1 histidine phosphatase family protein -
NRK31_RS05960 (1190448) 1190448..1190684 + 237 WP_000368687.1 hypothetical protein -
NRK31_RS05965 (1190681) 1190681..1190884 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NRK31_RS05970 (1191225) 1191225..1191485 + 261 WP_001059690.1 hypothetical protein Antitoxin
NRK31_RS05975 (1191514) 1191514..1191702 + 189 WP_000052076.1 hypothetical protein Toxin
NRK31_RS05980 (1191890) 1191890..1192459 + 570 WP_001106653.1 lipoprotein N-acylation protein LnsA -
NRK31_RS05985 (1192547) 1192547..1192831 + 285 WP_001004394.1 hypothetical protein -
NRK31_RS05990 (1192893) 1192893..1193111 + 219 WP_000005884.1 hypothetical protein -
NRK31_RS05995 (1193606) 1193606..1193806 - 201 WP_001059082.1 cold-shock protein -
NRK31_RS06000 (1194163) 1194163..1194849 - 687 WP_001548082.1 thermonuclease family protein -
NRK31_RS06005 (1195190) 1195190..1195660 - 471 WP_000824472.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selq / selk / vWbp / clfA 1164625..1209579 44954


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T279173 WP_000052076.1 NZ_CP123852:1191514-1191702 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT279173 WP_001059690.1 NZ_CP123852:1191225-1191485 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References