279172

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 1173886..1174418 Replicon chromosome
Accession NZ_CP123852
Organism Staphylococcus aureus strain 5812R

Toxin (Protein)


Gene name TscT Uniprot ID Q8VLW9
Locus tag NRK31_RS05840 Protein ID WP_001103944.1
Coordinates 1173886..1174206 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag NRK31_RS05845 Protein ID WP_001058492.1
Coordinates 1174209..1174418 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NRK31_RS05810 (1168973) 1168973..1169314 - 342 WP_042727540.1 hypothetical protein -
NRK31_RS05815 (1169888) 1169888..1170529 - 642 WP_042727541.1 pathogenicity island protein -
NRK31_RS05820 (1170526) 1170526..1170810 - 285 WP_042727542.1 hypothetical protein -
NRK31_RS05825 (1170812) 1170812..1171174 - 363 WP_042727543.1 hypothetical protein -
NRK31_RS05830 (1171476) 1171476..1172933 - 1458 WP_042727544.1 virulence-associated E family protein -
NRK31_RS05835 (1172950) 1172950..1173819 - 870 WP_042727545.1 primase alpha helix C-terminal domain-containing protein -
NRK31_RS05840 (1173886) 1173886..1174206 - 321 WP_001103944.1 DUF1474 family protein Toxin
NRK31_RS05845 (1174209) 1174209..1174418 - 210 WP_001058492.1 hypothetical protein Antitoxin
NRK31_RS05850 (1174411) 1174411..1174557 - 147 WP_012990927.1 hypothetical protein -
NRK31_RS05855 (1174569) 1174569..1174841 - 273 WP_001138298.1 helix-turn-helix domain-containing protein -
NRK31_RS05860 (1174842) 1174842..1175054 - 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
NRK31_RS05865 (1175204) 1175204..1175938 + 735 WP_000142630.1 helix-turn-helix transcriptional regulator -
NRK31_RS05870 (1176113) 1176113..1176841 + 729 WP_001033317.1 staphylococcal enterotoxin type Q -
NRK31_RS05875 (1176865) 1176865..1177593 + 729 WP_042727546.1 staphylococcal enterotoxin type K -
NRK31_RS05880 (1177681) 1177681..1178901 + 1221 WP_000264181.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selq / selk / vWbp / clfA 1164625..1209579 44954


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-90)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12636.31 Da        Isoelectric Point: 4.8519

>T279172 WP_001103944.1 NZ_CP123852:c1174206-1173886 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDAKKLKITE

Download         Length: 321 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT279172 WP_001058492.1 NZ_CP123852:c1174418-1174209 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q8VLW9

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References