Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 361329..362119 | Replicon | plasmid pAtH25_79a |
| Accession | NZ_CP123849 | ||
| Organism | Agrobacterium fabacearum strain H25/79 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1S7NFF1 |
| Locus tag | G6L82_RS24670 | Protein ID | WP_019565755.1 |
| Coordinates | 361622..362119 (+) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | A0A1S7NER6 |
| Locus tag | G6L82_RS24665 | Protein ID | WP_019565754.1 |
| Coordinates | 361329..361625 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L82_RS24645 (G6L82_024645) | 356697..358421 | + | 1725 | WP_019565751.1 | ABC transporter ATP-binding protein | - |
| G6L82_RS24650 (G6L82_024650) | 358466..359653 | + | 1188 | WP_145166916.1 | galactarate dehydratase | - |
| G6L82_RS24655 (G6L82_024655) | 359640..360506 | + | 867 | WP_145166983.1 | aldose 1-epimerase | - |
| G6L82_RS24660 (G6L82_024660) | 360716..361146 | + | 431 | Protein_368 | DDE-type integrase/transposase/recombinase | - |
| G6L82_RS24665 (G6L82_024665) | 361329..361625 | + | 297 | WP_019565754.1 | DUF1778 domain-containing protein | Antitoxin |
| G6L82_RS24670 (G6L82_024670) | 361622..362119 | + | 498 | WP_019565755.1 | GNAT family N-acetyltransferase | Toxin |
| G6L82_RS24675 (G6L82_024675) | 362738..363286 | + | 549 | WP_019565757.1 | TRAP transporter small permease subunit | - |
| G6L82_RS24680 (G6L82_024680) | 363304..364809 | + | 1506 | WP_173995354.1 | TRAP transporter large permease subunit | - |
| G6L82_RS24685 (G6L82_024685) | 364873..365985 | + | 1113 | WP_065703185.1 | TRAP transporter substrate-binding protein | - |
| G6L82_RS24690 (G6L82_024690) | 366049..366681 | - | 633 | WP_173995355.1 | response regulator transcription factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..628949 | 628949 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17725.27 Da Isoelectric Point: 6.8629
>T279167 WP_019565755.1 NZ_CP123849:361622-362119 [Agrobacterium fabacearum]
VTLSAPVPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALASGSVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNT
VTLSAPVPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALASGSVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNT
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1S7NFF1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1S7NER6 |