Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 348723..349393 | Replicon | plasmid pAtH25_79a |
| Accession | NZ_CP123849 | ||
| Organism | Agrobacterium fabacearum strain H25/79 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | G6L82_RS24610 | Protein ID | WP_003517201.1 |
| Coordinates | 348974..349393 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A7U5CZ71 |
| Locus tag | G6L82_RS24605 | Protein ID | WP_038496682.1 |
| Coordinates | 348723..348977 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L82_RS24595 (G6L82_024595) | 346193..347200 | + | 1008 | WP_173995352.1 | sensor histidine kinase | - |
| G6L82_RS24600 (G6L82_024600) | 347734..348339 | - | 606 | WP_065662894.1 | J domain-containing protein | - |
| G6L82_RS24605 (G6L82_024605) | 348723..348977 | + | 255 | WP_038496682.1 | plasmid stabilization protein | Antitoxin |
| G6L82_RS24610 (G6L82_024610) | 348974..349393 | + | 420 | WP_003517201.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| G6L82_RS24615 (G6L82_024615) | 349613..350509 | - | 897 | WP_013637432.1 | dihydrodipicolinate synthase family protein | - |
| G6L82_RS24620 (G6L82_024620) | 350542..351423 | - | 882 | WP_145166914.1 | SMP-30/gluconolactonase/LRE family protein | - |
| G6L82_RS24625 (G6L82_024625) | 351479..352198 | - | 720 | WP_003517195.1 | FCD domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..628949 | 628949 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15036.22 Da Isoelectric Point: 5.1532
>T279166 WP_003517201.1 NZ_CP123849:348974-349393 [Agrobacterium fabacearum]
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|