Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 219353..219933 Replicon plasmid pAtH25_79a
Accession NZ_CP123849
Organism Agrobacterium fabacearum strain H25/79

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag G6L82_RS23955 Protein ID WP_035201034.1
Coordinates 219353..219736 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID F0LFX8
Locus tag G6L82_RS23960 Protein ID WP_013637280.1
Coordinates 219733..219933 (-) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G6L82_RS23930 (G6L82_023930) 215491..216159 - 669 WP_065706112.1 GntR family transcriptional regulator -
G6L82_RS23935 (G6L82_023935) 216243..216863 + 621 WP_173995475.1 C39 family peptidase -
G6L82_RS23940 (G6L82_023940) 216909..217976 + 1068 WP_019565647.1 D-alanine--D-alanine ligase family protein -
G6L82_RS23945 (G6L82_023945) 218165..218428 + 264 WP_013637284.1 hypothetical protein -
G6L82_RS23950 (G6L82_023950) 218440..219138 + 699 WP_035201036.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
G6L82_RS23955 (G6L82_023955) 219353..219736 - 384 WP_035201034.1 type II toxin-antitoxin system VapC family toxin Toxin
G6L82_RS23960 (G6L82_023960) 219733..219933 - 201 WP_013637280.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
G6L82_RS23965 (G6L82_023965) 220159..221100 - 942 WP_173995476.1 AraC family transcriptional regulator -
G6L82_RS23970 (G6L82_023970) 221192..222169 + 978 WP_173995477.1 oxidoreductase -
G6L82_RS23975 (G6L82_023975) 222435..222881 - 447 WP_076846001.1 carboxymuconolactone decarboxylase family protein -
G6L82_RS23980 (G6L82_023980) 222974..223411 - 438 WP_003517453.1 cupin domain-containing protein -
G6L82_RS23985 (G6L82_023985) 223425..224177 - 753 WP_173995478.1 SDR family oxidoreductase -
G6L82_RS23990 (G6L82_023990) 224189..224701 - 513 WP_019565668.1 Rrf2 family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..628949 628949


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-112)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14251.32 Da        Isoelectric Point: 6.6030

>T279165 WP_035201034.1 NZ_CP123849:c219736-219353 [Agrobacterium fabacearum]
VILVDTSIWIDHFRYDDSELRKIINDDQLLCHPFVVGELALGSLRERAAVLEFLTAQREALIATHAEVMTIIDRHSIFSM
GIGYTDAHLLTSTLLDRRSSLWTRDKRLAAAAQKVGAALYPHAQASH

Download         Length: 384 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7197.28 Da        Isoelectric Point: 10.7407

>AT279165 WP_013637280.1 NZ_CP123849:c219933-219733 [Agrobacterium fabacearum]
MRSTINIDDNLMERAKSLTGTKETAALVRQALETLVRVESGKRLIALGGSMPEAEASPRRRSDVAK

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB F0LFX8

References