Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 108101..108648 | Replicon | plasmid pAtH25_79a |
| Accession | NZ_CP123849 | ||
| Organism | Agrobacterium fabacearum strain H25/79 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | G6L82_RS23395 | Protein ID | WP_173995409.1 |
| Coordinates | 108355..108648 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | F0LFW5 |
| Locus tag | G6L82_RS23390 | Protein ID | WP_013637268.1 |
| Coordinates | 108101..108355 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L82_RS23365 (G6L82_023365) | 104530..104799 | + | 270 | WP_035201239.1 | hypothetical protein | - |
| G6L82_RS23370 (G6L82_023370) | 104814..106028 | + | 1215 | WP_173995407.1 | low temperature requirement protein A | - |
| G6L82_RS23375 (G6L82_023375) | 106041..106613 | + | 573 | WP_051376994.1 | DUF924 family protein | - |
| G6L82_RS23380 (G6L82_023380) | 106692..107450 | + | 759 | WP_035201237.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| G6L82_RS23385 (G6L82_023385) | 107543..107893 | + | 351 | WP_173995408.1 | hypothetical protein | - |
| G6L82_RS23390 (G6L82_023390) | 108101..108355 | + | 255 | WP_013637268.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| G6L82_RS23395 (G6L82_023395) | 108355..108648 | + | 294 | WP_173995409.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| G6L82_RS23400 (G6L82_023400) | 108786..109628 | - | 843 | WP_236768996.1 | hypothetical protein | - |
| G6L82_RS23405 (G6L82_023405) | 109625..110881 | - | 1257 | WP_173995411.1 | MSMEG_0569 family flavin-dependent oxidoreductase | - |
| G6L82_RS23410 (G6L82_023410) | 110893..111171 | - | 279 | WP_013637307.1 | MSMEG_0570 family nitrogen starvation response protein | - |
| G6L82_RS23415 (G6L82_023415) | 111164..112135 | - | 972 | WP_173995412.1 | sll0787 family AIR synthase-like protein | - |
| G6L82_RS23420 (G6L82_023420) | 112135..112674 | - | 540 | WP_173995413.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..628949 | 628949 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11117.71 Da Isoelectric Point: 5.8932
>T279163 WP_173995409.1 NZ_CP123849:108355-108648 [Agrobacterium fabacearum]
MPFSLSVQAEEDIISIAEEGIRIFGALVARQYHDELFALLELIATNPRMARERHEISPPVRIHPFKAHPVVYRVIEDGSV
FVIRIRHGHEDWAGDSF
MPFSLSVQAEEDIISIAEEGIRIFGALVARQYHDELFALLELIATNPRMARERHEISPPVRIHPFKAHPVVYRVIEDGSV
FVIRIRHGHEDWAGDSF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|